Citrus Sinensis ID: 016832

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--
MEECRPLKCDNRLKRRPLTPIRVFRGLICLLVFFFTAFMFLVYFAPIIAIILRMFSVHHCRKATSFLFGLWLALWPFLFEKINRTTMVFSGDIVPVEERVLLMANHRTEVDWMYVWDLALRKGCLGYIKYILKSSLMKLPVFGWGFHILEFISVERNWEIDEHVMRQMLSTFRNPNDPLWLTIFPEGTDFTEEKRNRSQKFAADVGLPVLTNVLLPKTRGFCLCLETLRNTLDAVYDMTIAYKNPCPSFMDNVFGVDPSEVHIHVRRIPVKEIPASETDAAAWLMDAFQLKDQLLDKFNAQGHFPNQCQENELSTLKCLVNFIVVISLTAIFTYLTLFSSIWYKIYVGLACTSLASVTYFNIHPMLVVGFSKAMFCCKKTKK
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEECccccccccEEEEEccccccHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHccEEEccccHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHcccccccEEEEEEEECccccccccccccccccCEEEEEEEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
*************KRRPLTPIRVFRGLICLLVFFFTAFMFLVYFAPIIAIILRMFSVHHCRKATSFLFGLWLALWPFLFEKINRTTMVFSGDIVPVEERVLLMANHRTEVDWMYVWDLALRKGCLGYIKYILKSSLMKLPVFGWGFHILEFISVERNWEIDEHVMRQMLSTFRNPNDPLWLTIFPEGTDFTEEK*****KFAADVGLPVLTNVLLPKTRGFCLCLETLRNTLDAVYDMTIAYKNPCPSFMDNVFGVDPSEVHIHVRRIPVKEIPASETDAAAWLMDAFQLKDQLLDKFNAQGHFPNQCQENELSTLKCLVNFIVVISLTAIFTYLTLFSSIWYKIYVGLACTSLASVTYFNIHPMLVV**************
xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEECRPLKCDNRLKRRPLTPIRVFRGLICLLVFFFTAFMFLVYFAPIIAIILRMFSVHHCRKATSFLFGLWLALWPFLFEKINRTTMVFSGDIVPVEERVLLMANHRTEVDWMYVWDLALRKGCLGYIKYILKSSLMKLPVFGWGFHILEFISVERNWEIDEHVMRQMLSTFRNPNDPLWLTIFPEGTDFTEEKRNRSQKFAADVGLPVLTNVLLPKTRGFCLCLETLRNTLDAVYDMTIAYKNPCPSFMDNVFGVDPSEVHIHVRRIPVKEIPASETDAAAWLMDAFQLKDQLLDKFNAQGHFPNQCQENELSTLKCLVNFIVVISLTAIFTYLTLFSSIWYKIYVGLACTSLASVTYFNIHPMLVVGFSKAMFCCKKTKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 4 May convert lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position (By similarity). Has no activity when expressed in bacteria or yeast.probableQ8L4Y2
Lysocardiolipin acyltransferase 1 Acyl-CoA:lysocardiolipin acyltransferase. Possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. Recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. Required for establishment of the hematopoietic and endothelial lineages.probableQ5F3X0
Lysocardiolipin acyltransferase 1 Acyl-CoA:lysocardiolipin acyltransferase. Possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. Recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. Acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. Converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. Required for establishment of the hematopoietic and endothelial lineages.probableQ3UN02

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.511-acylglycerol-3-phosphate O-acyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IUQ, chain A
Confidence level:confident
Coverage over the Query: 83-215
View the alignment between query and template
View the model in PyMOL