Query         016837
Match_columns 381
No_of_seqs    94 out of 96
Neff          3.1 
Searched_HMMs 46136
Date          Fri Mar 29 03:15:35 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/016837.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/016837hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07800 DUF1644:  Protein of u 100.0 1.3E-91 2.9E-96  623.5  11.7  162   48-251     1-162 (162)
  2 PLN03208 E3 ubiquitin-protein   95.2   0.016 3.5E-07   54.5   3.3   44   39-95      8-51  (193)
  3 PHA02929 N1R/p28-like protein;  92.2    0.11 2.4E-06   50.0   2.9   14   47-60    172-185 (238)
  4 KOG4172 Predicted E3 ubiquitin  91.2   0.084 1.8E-06   41.8   0.8   23   45-68      4-26  (62)
  5 PF13909 zf-H2C2_5:  C2H2-type   91.0    0.14 2.9E-06   32.1   1.5   21  202-222     4-24  (24)
  6 PF13920 zf-C3HC4_3:  Zinc fing  85.0    0.28   6E-06   35.5   0.0   21   48-68      1-21  (50)
  7 PHA02926 zinc finger-like prot  82.8     1.2 2.5E-05   43.6   3.2   16   45-60    166-181 (242)
  8 KOG3002 Zn finger protein [Gen  82.0     1.3 2.7E-05   44.1   3.2   29  195-223   135-165 (299)
  9 TIGR00599 rad18 DNA repair pro  80.1    0.95 2.1E-05   46.7   1.7   20   48-67     25-44  (397)
 10 PF03145 Sina:  Seven in absent  73.7    0.84 1.8E-05   41.4  -0.7   29  195-223    43-73  (198)
 11 PF13923 zf-C3HC4_2:  Zinc fing  73.2    0.99 2.2E-05   31.2  -0.2   31   52-95      1-32  (39)
 12 PF12678 zf-rbx1:  RING-H2 zinc  70.6     2.6 5.6E-05   33.3   1.5   44   49-94     19-64  (73)
 13 PF15227 zf-C3HC4_4:  zinc fing  67.4     1.6 3.4E-05   31.4  -0.3   17   52-68      1-17  (42)
 14 KOG2164 Predicted E3 ubiquitin  67.3     2.3 4.9E-05   45.5   0.7   35   49-96    186-220 (513)
 15 KOG0825 PHD Zn-finger protein   66.5     2.5 5.5E-05   47.7   1.0   39   44-91    210-248 (1134)
 16 smart00184 RING Ring finger. E  63.1       3 6.5E-05   26.3   0.5   30   52-94      1-30  (39)
 17 COG2835 Uncharacterized conser  50.8     6.2 0.00013   31.5   0.5    9  170-178     9-17  (60)
 18 KOG4692 Predicted E3 ubiquitin  50.3       7 0.00015   40.9   0.9   23   46-68    419-441 (489)
 19 KOG2177 Predicted E3 ubiquitin  46.2     5.8 0.00012   34.2  -0.4   21   48-68     12-32  (386)
 20 PF06679 DUF1180:  Protein of u  45.9      13 0.00028   34.5   1.8   10  290-299   108-117 (163)
 21 COG5574 PEX10 RING-finger-cont  44.3     9.1  0.0002   38.2   0.6   21   48-68    214-234 (271)
 22 PRK11827 hypothetical protein;  43.6     9.9 0.00021   30.1   0.6   11  170-180     9-19  (60)
 23 smart00504 Ubox Modified RING   41.0      12 0.00026   27.3   0.7   19   49-67      1-19  (63)
 24 PF11793 FANCL_C:  FANCL C-term  40.7      28 0.00061   27.4   2.7   44   49-98      2-46  (70)
 25 KOG1785 Tyrosine kinase negati  40.1      10 0.00022   40.4   0.2   17  169-185   405-421 (563)
 26 PF00097 zf-C3HC4:  Zinc finger  39.8     9.6 0.00021   26.0   0.0   16   52-67      1-17  (41)
 27 KOG0823 Predicted E3 ubiquitin  38.7     9.9 0.00022   37.1  -0.1   23   46-68     44-66  (230)
 28 cd00162 RING RING-finger (Real  35.6      12 0.00027   24.3   0.0   32   51-94      1-32  (45)
 29 KOG1006 Mitogen-activated prot  34.8      15 0.00033   37.6   0.5   29  184-216   299-327 (361)
 30 PF13894 zf-C2H2_4:  C2H2-type   34.4      30 0.00065   20.2   1.6   18  204-221     6-24  (24)
 31 KOG1001 Helicase-like transcri  33.1      25 0.00054   38.8   1.8   36   45-97    450-485 (674)
 32 KOG4275 Predicted E3 ubiquitin  31.3      12 0.00026   38.2  -0.8   20   49-68    300-319 (350)
 33 smart00744 RINGv The RING-vari  28.2      41 0.00088   25.0   1.7   38   51-98      1-42  (49)
 34 PF10614 CsgF:  Type VIII secre  26.1 2.5E+02  0.0054   25.8   6.6   64  209-272    39-115 (142)
 35 PF13445 zf-RING_UBOX:  RING-ty  25.3      21 0.00045   26.2  -0.3   16   52-67      1-19  (43)
 36 COG2879 Uncharacterized small   24.9      93   0.002   25.4   3.3   31  209-249    24-54  (65)
 37 KOG4029 Transcription factor H  23.7      48   0.001   31.1   1.7   47  186-235   107-154 (228)
 38 KOG0804 Cytoplasmic Zn-finger   22.9      33 0.00072   36.8   0.5   37   48-93    174-210 (493)
 39 cd00022 BIR Baculoviral inhibi  22.0      36 0.00077   25.7   0.4   21  168-188    33-53  (69)
 40 KOG0754 Mitochondrial oxodicar  21.6      60  0.0013   32.8   2.0   33   47-100    69-101 (294)

No 1  
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=100.00  E-value=1.3e-91  Score=623.46  Aligned_cols=162  Identities=56%  Similarity=1.132  Sum_probs=144.9

Q ss_pred             ccccCccccCCCcchhhhhccccCCCCcccccCCCCccchhHHHHHHhhcCCCCCCCCCCCCCCCCCCCCCCCCCccchh
Q 016837           48 DEISCPICMDHPHNAVLLICSSHDKGCRSYICDTSYRHSNCLDRYKKLRTSSRNNTTLSHSSPSHPQHNKGPGENNIQQA  127 (381)
Q Consensus        48 edatCPICME~PHNAVLLlCSSh~KGCRPYMCdTSyRHSNCLDQFkKa~~~~~~~~~~~~ss~~~~~~~~~~~~~~i~~~  127 (381)
                      |||+||||||||||||||+||||+|||||||||||||||||||||||||++++++.++++++.+...         +.. 
T Consensus         1 ed~~CpICme~PHNAVLLlCSS~~kgcRpymc~Ts~rhSNCLdqfkka~~~~~~~~~~~~~~~~~~~---------~~~-   70 (162)
T PF07800_consen    1 EDVTCPICMEHPHNAVLLLCSSHEKGCRPYMCDTSYRHSNCLDQFKKAYGKSSSSSSQSSSSAPSDS---------SSS-   70 (162)
T ss_pred             CCccCceeccCCCceEEEEeccccCCccccccCCccchhHHHHHHHHHhcCCCCccccccccCcCCC---------ccc-
Confidence            7999999999999999999999999999999999999999999999999999988766654322111         000 


Q ss_pred             hhhhhhhcCCCCCCCCCCCccccccccccccccCCCccccccccCccccccccceEEcchHHHhhcccCCCCcccCCccc
Q 016837          128 DRLLEREGEGNLNPEAGNSQTFHERTELEGLDVDNSSESILSLKCPMCRGAILGWEVVEEARKYLNLKRRTCSRESCSFV  207 (381)
Q Consensus       128 ~~~~~~~~e~~~~~~~~~s~~l~~~~~~~~~~~~~s~~~~~~L~CPLCRG~VkGWtVVe~AR~yLN~KkRSCs~E~CsF~  207 (381)
                                                      .......+++|+||||||+|||||||++||+|||+|+||||+|+|+|+
T Consensus        71 --------------------------------~~~~~~~~~~L~CPLCRG~V~GWtvve~AR~~LN~K~RsC~~e~C~F~  118 (162)
T PF07800_consen   71 --------------------------------ESSESQEQPELACPLCRGEVKGWTVVEPARRFLNAKKRSCSQESCSFS  118 (162)
T ss_pred             --------------------------------ccccccccccccCccccCceeceEEchHHHHHhccCCccCcccccccc
Confidence                                            011223568899999999999999999999999999999999999999


Q ss_pred             ccHHHHHHHHhhhCCCCCCCCCCchHHHHHHHHhhhhhhhHHHH
Q 016837          208 GNYQELRRHARRVHPTTRPSDIDPSRERAWRRLEHQREYSDIVS  251 (381)
Q Consensus       208 GtY~ELRKHaR~~HP~aRPseVDP~Rqr~W~rLE~erE~~DvlS  251 (381)
                      |||.|||||||.+||++||++|||+||++|++||+||||+||||
T Consensus       119 GtY~eLrKHar~~HP~~rP~~vDP~rq~~W~~le~~re~~D~iS  162 (162)
T PF07800_consen  119 GTYSELRKHARSEHPSARPSEVDPQRQRDWERLEREREYGDVIS  162 (162)
T ss_pred             cCHHHHHHHHHhhCCCCCCccCCHHHHHHHHHHHHhhhhhcccC
Confidence            99999999999999999999999999999999999999999997


No 2  
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=95.23  E-value=0.016  Score=54.45  Aligned_cols=44  Identities=23%  Similarity=0.531  Sum_probs=30.4

Q ss_pred             hhHHhhcccccccCccccCCCcchhhhhccccCCCCcccccCCCCccchhHHHHHHh
Q 016837           39 DIHALHKELDEISCPICMDHPHNAVLLICSSHDKGCRSYICDTSYRHSNCLDRYKKL   95 (381)
Q Consensus        39 ~~~al~keWedatCPICME~PHNAVLLlCSSh~KGCRPYMCdTSyRHSNCLDQFkKa   95 (381)
                      |.+.+...=++..||||+|...++|++.|- | .-           ...||.++-++
T Consensus         8 ~~~~~~~~~~~~~CpICld~~~dPVvT~CG-H-~F-----------C~~CI~~wl~~   51 (193)
T PLN03208          8 DDTTLVDSGGDFDCNICLDQVRDPVVTLCG-H-LF-----------CWPCIHKWTYA   51 (193)
T ss_pred             ccceeccCCCccCCccCCCcCCCcEEcCCC-c-hh-----------HHHHHHHHHHh
Confidence            333445555789999999999999988773 2 22           34688877553


No 3  
>PHA02929 N1R/p28-like protein; Provisional
Probab=92.20  E-value=0.11  Score=49.99  Aligned_cols=14  Identities=29%  Similarity=0.717  Sum_probs=10.8

Q ss_pred             cccccCccccCCCc
Q 016837           47 LDEISCPICMDHPH   60 (381)
Q Consensus        47 WedatCPICME~PH   60 (381)
                      =++..||||||.-.
T Consensus       172 ~~~~eC~ICle~~~  185 (238)
T PHA02929        172 SKDKECAICMEKVY  185 (238)
T ss_pred             CCCCCCccCCcccc
Confidence            35689999999744


No 4  
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=91.23  E-value=0.084  Score=41.84  Aligned_cols=23  Identities=35%  Similarity=0.869  Sum_probs=19.8

Q ss_pred             cccccccCccccCCCcchhhhhcc
Q 016837           45 KELDEISCPICMDHPHNAVLLICS   68 (381)
Q Consensus        45 keWedatCPICME~PHNAVLLlCS   68 (381)
                      .+|. .-|-||||+|-|.||..|-
T Consensus         4 ~~~~-dECTICye~pvdsVlYtCG   26 (62)
T KOG4172|consen    4 GQWS-DECTICYEHPVDSVLYTCG   26 (62)
T ss_pred             cccc-cceeeeccCcchHHHHHcc
Confidence            4677 7899999999999997774


No 5  
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=91.04  E-value=0.14  Score=32.07  Aligned_cols=21  Identities=38%  Similarity=0.811  Sum_probs=18.4

Q ss_pred             cCCcccccHHHHHHHHhhhCC
Q 016837          202 ESCSFVGNYQELRRHARRVHP  222 (381)
Q Consensus       202 E~CsF~GtY~ELRKHaR~~HP  222 (381)
                      .-|+|+.+..+|++|.+..||
T Consensus         4 ~~C~y~t~~~~l~~H~~~~H~   24 (24)
T PF13909_consen    4 PHCSYSTSKSNLKRHLKRHHP   24 (24)
T ss_dssp             SSSS-EESHHHHHHHHHHHHS
T ss_pred             CCCCCcCCHHHHHHHHHhhCc
Confidence            459999999999999999997


No 6  
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=85.05  E-value=0.28  Score=35.48  Aligned_cols=21  Identities=43%  Similarity=1.176  Sum_probs=16.9

Q ss_pred             ccccCccccCCCcchhhhhcc
Q 016837           48 DEISCPICMDHPHNAVLLICS   68 (381)
Q Consensus        48 edatCPICME~PHNAVLLlCS   68 (381)
                      |+..|+||++.|.++|++-|-
T Consensus         1 ~~~~C~iC~~~~~~~~~~pCg   21 (50)
T PF13920_consen    1 EDEECPICFENPRDVVLLPCG   21 (50)
T ss_dssp             -HSB-TTTSSSBSSEEEETTC
T ss_pred             CcCCCccCCccCCceEEeCCC
Confidence            567899999999999998863


No 7  
>PHA02926 zinc finger-like protein; Provisional
Probab=82.83  E-value=1.2  Score=43.64  Aligned_cols=16  Identities=25%  Similarity=0.476  Sum_probs=12.3

Q ss_pred             cccccccCccccCCCc
Q 016837           45 KELDEISCPICMDHPH   60 (381)
Q Consensus        45 keWedatCPICME~PH   60 (381)
                      +.-++..|+||||.-+
T Consensus       166 ~~SkE~eCgICmE~I~  181 (242)
T PHA02926        166 RVSKEKECGICYEVVY  181 (242)
T ss_pred             hccCCCCCccCccccc
Confidence            3446799999999744


No 8  
>KOG3002 consensus Zn finger protein [General function prediction only]
Probab=82.00  E-value=1.3  Score=44.15  Aligned_cols=29  Identities=24%  Similarity=0.692  Sum_probs=26.1

Q ss_pred             cCCCCccc--CCcccccHHHHHHHHhhhCCC
Q 016837          195 KRRTCSRE--SCSFVGNYQELRRHARRVHPT  223 (381)
Q Consensus       195 KkRSCs~E--~CsF~GtY~ELRKHaR~~HP~  223 (381)
                      .+-+|.+-  .|+|.|.|++|..|.+..|+.
T Consensus       135 ~~~~CP~p~~~C~~~G~~~~l~~H~~~~hk~  165 (299)
T KOG3002|consen  135 RPCSCPVPGAECKYTGSYKDLYAHLNDTHKS  165 (299)
T ss_pred             CCcCCCCCcccCCccCcHHHHHHHHHhhChh
Confidence            45678888  999999999999999999987


No 9  
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=80.10  E-value=0.95  Score=46.70  Aligned_cols=20  Identities=35%  Similarity=0.707  Sum_probs=17.0

Q ss_pred             ccccCccccCCCcchhhhhc
Q 016837           48 DEISCPICMDHPHNAVLLIC   67 (381)
Q Consensus        48 edatCPICME~PHNAVLLlC   67 (381)
                      +..+||||++...+.|++-|
T Consensus        25 ~~l~C~IC~d~~~~PvitpC   44 (397)
T TIGR00599        25 TSLRCHICKDFFDVPVLTSC   44 (397)
T ss_pred             cccCCCcCchhhhCccCCCC
Confidence            56899999999999987754


No 10 
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=73.75  E-value=0.84  Score=41.35  Aligned_cols=29  Identities=31%  Similarity=0.653  Sum_probs=21.1

Q ss_pred             cCCCCcc--cCCcccccHHHHHHHHhhhCCC
Q 016837          195 KRRTCSR--ESCSFVGNYQELRRHARRVHPT  223 (381)
Q Consensus       195 KkRSCs~--E~CsF~GtY~ELRKHaR~~HP~  223 (381)
                      ++-.|..  .+|+|.|++++|.+|.+..|+.
T Consensus        43 ~p~~CP~~~~~C~~~G~~~~l~~Hl~~~H~~   73 (198)
T PF03145_consen   43 RPCSCPFPGSGCDWQGSYKELLDHLRDKHSW   73 (198)
T ss_dssp             SEEE-SSSSTT---EEECCCHHHHHHHHTTT
T ss_pred             cCCcCCCCCCCccccCCHHHHHHHHHHHCCC
Confidence            4456777  8899999999999999999953


No 11 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=73.21  E-value=0.99  Score=31.16  Aligned_cols=31  Identities=35%  Similarity=1.010  Sum_probs=20.0

Q ss_pred             CccccCCCcchh-hhhccccCCCCcccccCCCCccchhHHHHHHh
Q 016837           52 CPICMDHPHNAV-LLICSSHDKGCRSYICDTSYRHSNCLDRYKKL   95 (381)
Q Consensus        52 CPICME~PHNAV-LLlCSSh~KGCRPYMCdTSyRHSNCLDQFkKa   95 (381)
                      ||||++.+-|+| ++.| .|           +| ...|+.++.+.
T Consensus         1 C~iC~~~~~~~~~~~~C-GH-----------~f-C~~C~~~~~~~   32 (39)
T PF13923_consen    1 CPICLDELRDPVVVTPC-GH-----------SF-CKECIEKYLEK   32 (39)
T ss_dssp             ETTTTSB-SSEEEECTT-SE-----------EE-EHHHHHHHHHC
T ss_pred             CCCCCCcccCcCEECCC-CC-----------ch-hHHHHHHHHHC
Confidence            899999999995 4443 22           22 34677777664


No 12 
>PF12678 zf-rbx1:  RING-H2 zinc finger;  InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This domain constitutes a conserved region found in proteins that participate in diverse functions relevant to chromosome metabolism and cell cycle control [].The domain contains 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding.; PDB: 4A0C_D 4A0L_I 4A0K_B 2ECL_A 1LDK_C 3RTR_F 3DQV_Y 1U6G_B 1LDJ_B 2HYE_D ....
Probab=70.64  E-value=2.6  Score=33.30  Aligned_cols=44  Identities=20%  Similarity=0.616  Sum_probs=27.8

Q ss_pred             cccCccccCCCcchhhhhccccCCCCcccc--cCCCCccchhHHHHHH
Q 016837           49 EISCPICMDHPHNAVLLICSSHDKGCRSYI--CDTSYRHSNCLDRYKK   94 (381)
Q Consensus        49 datCPICME~PHNAVLLlCSSh~KGCRPYM--CdTSyRHSNCLDQFkK   94 (381)
                      +-.|.||++.-+... .-|......|-..+  |+-.| |.-||.|+-+
T Consensus        19 ~d~C~IC~~~l~~~~-~~~~~~~~~~~i~~~~C~H~F-H~~Ci~~Wl~   64 (73)
T PF12678_consen   19 DDNCAICREPLEDPC-PECQAPQDECPIVWGPCGHIF-HFHCISQWLK   64 (73)
T ss_dssp             CSBETTTTSBTTSTT-CCHHHCTTTS-EEEETTSEEE-EHHHHHHHHT
T ss_pred             CCcccccChhhhChh-hhhcCCccccceEecccCCCE-EHHHHHHHHh
Confidence            445999999886654 25555555565543  66554 6788877753


No 13 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=67.37  E-value=1.6  Score=31.36  Aligned_cols=17  Identities=47%  Similarity=1.060  Sum_probs=13.8

Q ss_pred             CccccCCCcchhhhhcc
Q 016837           52 CPICMDHPHNAVLLICS   68 (381)
Q Consensus        52 CPICME~PHNAVLLlCS   68 (381)
                      ||||++.-++.|.|.|.
T Consensus         1 CpiC~~~~~~Pv~l~CG   17 (42)
T PF15227_consen    1 CPICLDLFKDPVSLPCG   17 (42)
T ss_dssp             ETTTTSB-SSEEE-SSS
T ss_pred             CCccchhhCCccccCCc
Confidence            89999999999999884


No 14 
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=67.27  E-value=2.3  Score=45.50  Aligned_cols=35  Identities=31%  Similarity=0.894  Sum_probs=26.2

Q ss_pred             cccCccccCCCcchhhhhccccCCCCcccccCCCCccchhHHHHHHhh
Q 016837           49 EISCPICMDHPHNAVLLICSSHDKGCRSYICDTSYRHSNCLDRYKKLR   96 (381)
Q Consensus        49 datCPICME~PHNAVLLlCSSh~KGCRPYMCdTSyRHSNCLDQFkKa~   96 (381)
                      +..||||++.|==||+-.|- |-     | |      -+||=||-...
T Consensus       186 ~~~CPICL~~~~~p~~t~CG-Hi-----F-C------~~CiLqy~~~s  220 (513)
T KOG2164|consen  186 DMQCPICLEPPSVPVRTNCG-HI-----F-C------GPCILQYWNYS  220 (513)
T ss_pred             CCcCCcccCCCCcccccccC-ce-----e-e------HHHHHHHHhhh
Confidence            99999999999999987763 21     1 1      26888997643


No 15 
>KOG0825 consensus PHD Zn-finger protein [General function prediction only]
Probab=66.54  E-value=2.5  Score=47.66  Aligned_cols=39  Identities=41%  Similarity=0.874  Sum_probs=31.9

Q ss_pred             hcccccccCccccCCCcchhhhhccccCCCCcccccCCCCccchhHHH
Q 016837           44 HKELDEISCPICMDHPHNAVLLICSSHDKGCRSYICDTSYRHSNCLDR   91 (381)
Q Consensus        44 ~keWedatCPICME~PHNAVLLlCSSh~KGCRPYMCdTSyRHSNCLDQ   91 (381)
                      .-+=|.+.|.||--+=|--|||||=+         ||--|-|+-|||=
T Consensus       210 ~~~~E~~~C~IC~~~DpEdVLLLCDs---------CN~~~YH~YCLDP  248 (1134)
T KOG0825|consen  210 GLSQEEVKCDICTVHDPEDVLLLCDS---------CNKVYYHVYCLDP  248 (1134)
T ss_pred             CcccccccceeeccCChHHhheeecc---------cccceeeccccCc
Confidence            33457889999999999999999987         6666778888873


No 16 
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=63.06  E-value=3  Score=26.28  Aligned_cols=30  Identities=30%  Similarity=0.970  Sum_probs=21.7

Q ss_pred             CccccCCCcchhhhhccccCCCCcccccCCCCccchhHHHHHH
Q 016837           52 CPICMDHPHNAVLLICSSHDKGCRSYICDTSYRHSNCLDRYKK   94 (381)
Q Consensus        52 CPICME~PHNAVLLlCSSh~KGCRPYMCdTSyRHSNCLDQFkK   94 (381)
                      |+||++...+.++|.|.            -.| |.+|++++-+
T Consensus         1 C~iC~~~~~~~~~~~C~------------H~~-c~~C~~~~~~   30 (39)
T smart00184        1 CPICLEELKDPVVLPCG------------HTF-CRSCIRKWLK   30 (39)
T ss_pred             CCcCccCCCCcEEecCC------------ChH-HHHHHHHHHH
Confidence            89999998888877642            222 5678887765


No 17 
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=50.83  E-value=6.2  Score=31.50  Aligned_cols=9  Identities=56%  Similarity=1.678  Sum_probs=8.7

Q ss_pred             ccCcccccc
Q 016837          170 LKCPMCRGA  178 (381)
Q Consensus       170 L~CPLCRG~  178 (381)
                      |+||+|+|.
T Consensus         9 LaCP~~kg~   17 (60)
T COG2835           9 LACPVCKGP   17 (60)
T ss_pred             eeccCcCCc
Confidence            999999998


No 18 
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=50.32  E-value=7  Score=40.92  Aligned_cols=23  Identities=43%  Similarity=0.879  Sum_probs=21.3

Q ss_pred             ccccccCccccCCCcchhhhhcc
Q 016837           46 ELDEISCPICMDHPHNAVLLICS   68 (381)
Q Consensus        46 eWedatCPICME~PHNAVLLlCS   68 (381)
                      +-||-.||||--+|-|||.--|+
T Consensus       419 ~sEd~lCpICyA~pi~Avf~PC~  441 (489)
T KOG4692|consen  419 DSEDNLCPICYAGPINAVFAPCS  441 (489)
T ss_pred             CcccccCcceecccchhhccCCC
Confidence            36899999999999999999997


No 19 
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=46.19  E-value=5.8  Score=34.21  Aligned_cols=21  Identities=43%  Similarity=1.065  Sum_probs=17.0

Q ss_pred             ccccCccccCCCcchhhhhcc
Q 016837           48 DEISCPICMDHPHNAVLLICS   68 (381)
Q Consensus        48 edatCPICME~PHNAVLLlCS   68 (381)
                      +.++||||++.=-..++|-|-
T Consensus        12 ~~~~C~iC~~~~~~p~~l~C~   32 (386)
T KOG2177|consen   12 EELTCPICLEYFREPVLLPCG   32 (386)
T ss_pred             ccccChhhHHHhhcCcccccc
Confidence            789999999987777777664


No 20 
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=45.90  E-value=13  Score=34.48  Aligned_cols=10  Identities=10%  Similarity=0.348  Sum_probs=6.0

Q ss_pred             chhhhhHhhh
Q 016837          290 WTTFFLFHMI  299 (381)
Q Consensus       290 ~T~ffL~~~~  299 (381)
                      ..+||+|++|
T Consensus       108 ~i~yfvir~~  117 (163)
T PF06679_consen  108 AILYFVIRTF  117 (163)
T ss_pred             HHHHHHHHHH
Confidence            4456666665


No 21 
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=44.33  E-value=9.1  Score=38.21  Aligned_cols=21  Identities=19%  Similarity=0.656  Sum_probs=17.9

Q ss_pred             ccccCccccCCCcchhhhhcc
Q 016837           48 DEISCPICMDHPHNAVLLICS   68 (381)
Q Consensus        48 edatCPICME~PHNAVLLlCS   68 (381)
                      -|-.|+||||.||+++-+.|.
T Consensus       214 ~d~kC~lC~e~~~~ps~t~Cg  234 (271)
T COG5574         214 ADYKCFLCLEEPEVPSCTPCG  234 (271)
T ss_pred             cccceeeeecccCCccccccc
Confidence            466799999999999977775


No 22 
>PRK11827 hypothetical protein; Provisional
Probab=43.64  E-value=9.9  Score=30.13  Aligned_cols=11  Identities=36%  Similarity=1.307  Sum_probs=10.0

Q ss_pred             ccCcccccccc
Q 016837          170 LKCPMCRGAIL  180 (381)
Q Consensus       170 L~CPLCRG~Vk  180 (381)
                      |+||+|.|++.
T Consensus         9 LaCP~ckg~L~   19 (60)
T PRK11827          9 IACPVCNGKLW   19 (60)
T ss_pred             eECCCCCCcCe
Confidence            99999999875


No 23 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=41.00  E-value=12  Score=27.32  Aligned_cols=19  Identities=32%  Similarity=0.660  Sum_probs=15.4

Q ss_pred             cccCccccCCCcchhhhhc
Q 016837           49 EISCPICMDHPHNAVLLIC   67 (381)
Q Consensus        49 datCPICME~PHNAVLLlC   67 (381)
                      +..||||++.--|.|++-|
T Consensus         1 ~~~Cpi~~~~~~~Pv~~~~   19 (63)
T smart00504        1 EFLCPISLEVMKDPVILPS   19 (63)
T ss_pred             CcCCcCCCCcCCCCEECCC
Confidence            3579999999999887754


No 24 
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=40.71  E-value=28  Score=27.44  Aligned_cols=44  Identities=23%  Similarity=0.456  Sum_probs=17.4

Q ss_pred             cccCccccCCCc-chhhhhccccCCCCcccccCCCCccchhHHHHHHhhcC
Q 016837           49 EISCPICMDHPH-NAVLLICSSHDKGCRSYICDTSYRHSNCLDRYKKLRTS   98 (381)
Q Consensus        49 datCPICME~PH-NAVLLlCSSh~KGCRPYMCdTSyRHSNCLDQFkKa~~~   98 (381)
                      +..|+||+++=+ +.=     .-++.|..=.|.-.| |..||-++=.+..+
T Consensus         2 ~~~C~IC~~~~~~~~~-----~p~~~C~n~~C~~~f-H~~CL~~wf~~~~~   46 (70)
T PF11793_consen    2 ELECGICYSYRLDDGE-----IPDVVCPNPSCGKKF-HLLCLSEWFLSLEK   46 (70)
T ss_dssp             --S-SSS--SS-TT----------B--S-TT----B--SGGGHHHHHHHHS
T ss_pred             CCCCCcCCcEecCCCC-----cCceEcCCcccCCHH-HHHHHHHHHHHccc
Confidence            567999998755 211     124566666666544 88999877655443


No 25 
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]
Probab=40.14  E-value=10  Score=40.35  Aligned_cols=17  Identities=47%  Similarity=0.863  Sum_probs=14.3

Q ss_pred             cccCccccccccceEEc
Q 016837          169 SLKCPMCRGAILGWEVV  185 (381)
Q Consensus       169 ~L~CPLCRG~VkGWtVV  185 (381)
                      .-.||.||-+||||.-|
T Consensus       405 gq~CPFCRcEIKGte~v  421 (563)
T KOG1785|consen  405 GQTCPFCRCEIKGTEPV  421 (563)
T ss_pred             CCCCCceeeEeccccce
Confidence            36899999999999843


No 26 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=39.81  E-value=9.6  Score=25.96  Aligned_cols=16  Identities=50%  Similarity=1.215  Sum_probs=13.5

Q ss_pred             CccccCCCcchh-hhhc
Q 016837           52 CPICMDHPHNAV-LLIC   67 (381)
Q Consensus        52 CPICME~PHNAV-LLlC   67 (381)
                      ||||++.+-+.+ ++.|
T Consensus         1 C~iC~~~~~~~~~~~~C   17 (41)
T PF00097_consen    1 CPICLEPFEDPVILLPC   17 (41)
T ss_dssp             ETTTSSBCSSEEEETTT
T ss_pred             CCcCCccccCCCEEecC
Confidence            899999999988 6655


No 27 
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=38.66  E-value=9.9  Score=37.14  Aligned_cols=23  Identities=26%  Similarity=0.720  Sum_probs=19.2

Q ss_pred             ccccccCccccCCCcchhhhhcc
Q 016837           46 ELDEISCPICMDHPHNAVLLICS   68 (381)
Q Consensus        46 eWedatCPICME~PHNAVLLlCS   68 (381)
                      +=-.-.|.||+|-++.+||-+|=
T Consensus        44 ~~~~FdCNICLd~akdPVvTlCG   66 (230)
T KOG0823|consen   44 DGGFFDCNICLDLAKDPVVTLCG   66 (230)
T ss_pred             CCCceeeeeeccccCCCEEeecc
Confidence            34456799999999999998884


No 28 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=35.63  E-value=12  Score=24.35  Aligned_cols=32  Identities=31%  Similarity=0.935  Sum_probs=20.6

Q ss_pred             cCccccCCCcchhhhhccccCCCCcccccCCCCccchhHHHHHH
Q 016837           51 SCPICMDHPHNAVLLICSSHDKGCRSYICDTSYRHSNCLDRYKK   94 (381)
Q Consensus        51 tCPICME~PHNAVLLlCSSh~KGCRPYMCdTSyRHSNCLDQFkK   94 (381)
                      .|+||++...+.+.+.           -|+-.| |..|++++.+
T Consensus         1 ~C~iC~~~~~~~~~~~-----------~C~H~~-c~~C~~~~~~   32 (45)
T cd00162           1 ECPICLEEFREPVVLL-----------PCGHVF-CRSCIDKWLK   32 (45)
T ss_pred             CCCcCchhhhCceEec-----------CCCChh-cHHHHHHHHH
Confidence            5999999885544332           144343 6778887755


No 29 
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms]
Probab=34.80  E-value=15  Score=37.62  Aligned_cols=29  Identities=17%  Similarity=0.308  Sum_probs=17.1

Q ss_pred             EcchHHHhhcccCCCCcccCCcccccHHHHHHH
Q 016837          184 VVEEARKYLNLKRRTCSRESCSFVGNYQELRRH  216 (381)
Q Consensus       184 VVe~AR~yLN~KkRSCs~E~CsF~GtY~ELRKH  216 (381)
                      +.-+-+.|.|.    |-.-.=+-.-.|.+|.||
T Consensus       299 ~s~~~~~fint----Cl~Kd~~~Rpky~~Lk~~  327 (361)
T KOG1006|consen  299 YSFSMVRFINT----CLIKDRSDRPKYDDLKKF  327 (361)
T ss_pred             cCHHHHHHHHH----HhhcccccCcchhhhhcC
Confidence            34456667763    444444455678888775


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=34.40  E-value=30  Score=20.18  Aligned_cols=18  Identities=39%  Similarity=0.615  Sum_probs=13.3

Q ss_pred             Cccc-ccHHHHHHHHhhhC
Q 016837          204 CSFV-GNYQELRRHARRVH  221 (381)
Q Consensus       204 CsF~-GtY~ELRKHaR~~H  221 (381)
                      |.+. .++.+|++|.+..|
T Consensus         6 C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    6 CGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             TS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCcHHHHHHHHHhhC
Confidence            5443 57889999999877


No 31 
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]
Probab=33.15  E-value=25  Score=38.79  Aligned_cols=36  Identities=25%  Similarity=0.408  Sum_probs=27.9

Q ss_pred             cccccccCccccCCCcchhhhhccccCCCCcccccCCCCccchhHHHHHHhhc
Q 016837           45 KELDEISCPICMDHPHNAVLLICSSHDKGCRSYICDTSYRHSNCLDRYKKLRT   97 (381)
Q Consensus        45 keWedatCPICME~PHNAVLLlCSSh~KGCRPYMCdTSyRHSNCLDQFkKa~~   97 (381)
                      +=|.+..|+||+| +-.+|+-.|.                |..|.+.++++-.
T Consensus       450 ~l~~~~~c~ic~~-~~~~~it~c~----------------h~~c~~c~~~~i~  485 (674)
T KOG1001|consen  450 DLSVSHWCHICCD-LDSFFITRCG----------------HDFCVECLKKSIQ  485 (674)
T ss_pred             HHhhccccccccc-cccceeeccc----------------chHHHHHHHhccc
Confidence            3344489999999 8888877664                8999999998543


No 32 
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=31.28  E-value=12  Score=38.24  Aligned_cols=20  Identities=45%  Similarity=1.014  Sum_probs=18.0

Q ss_pred             cccCccccCCCcchhhhhcc
Q 016837           49 EISCPICMDHPHNAVLLICS   68 (381)
Q Consensus        49 datCPICME~PHNAVLLlCS   68 (381)
                      +-.|-||||-|-..|+|-|-
T Consensus       300 ~~LC~ICmDaP~DCvfLeCG  319 (350)
T KOG4275|consen  300 RRLCAICMDAPRDCVFLECG  319 (350)
T ss_pred             HHHHHHHhcCCcceEEeecC
Confidence            56799999999999999983


No 33 
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins. Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Class
Probab=28.16  E-value=41  Score=24.98  Aligned_cols=38  Identities=26%  Similarity=0.667  Sum_probs=25.3

Q ss_pred             cCccccC--CCcchhhhhccccCCCCcccccCC--CCccchhHHHHHHhhcC
Q 016837           51 SCPICMD--HPHNAVLLICSSHDKGCRSYICDT--SYRHSNCLDRYKKLRTS   98 (381)
Q Consensus        51 tCPICME--~PHNAVLLlCSSh~KGCRPYMCdT--SyRHSNCLDQFkKa~~~   98 (381)
                      .|-||++  .+-+..+          +|=.|-.  .|-|..||+++-....+
T Consensus         1 ~CrIC~~~~~~~~~l~----------~PC~C~G~~~~vH~~Cl~~W~~~~~~   42 (49)
T smart00744        1 ICRICHDEGDEGDPLV----------SPCRCKGSLKYVHQECLERWINESGN   42 (49)
T ss_pred             CccCCCCCCCCCCeeE----------eccccCCchhHHHHHHHHHHHHHcCC
Confidence            4889997  4444332          3444664  58899999999876543


No 34 
>PF10614 CsgF:  Type VIII secretion system (T8SS), CsgF protein;  InterPro: IPR018893  Fimbriae are cell-surface protein polymers, of e.g. Escherichia coli and Salmonella spp, that mediate interactions important for host and environmental persistence, development of biofilms, motility, colonisation and invasion of cells, and conjugation. Four general assembly pathways for different fimbriae have been proposed, one of which is extracellular nucleation-precipitation (ENP), that differs from the others in that fibre-growth occurs extracellularly. Thin aggregative fimbriae (Tafi) are the only fimbriae dependent on the ENP pathway. Tafi were first identified in Salmonella spp. and the controlling operon termed agf; however subsequent isolation of the homologous operon in E. coli led to its being called csg. Tafi are known as curli because, in the absence of extracellular polysaccharides, their morphology appears curled; however, when expressed with such polysaccharides their morphology appears as a tangled amorphous matrix []. CsgF is one of three putative curli assembly factors appearing to act as a nucleator protein. Unlike eukaryotic amyloid formation, curli biogenesis is a productive pathway requiring a specific assembly machinery []. 
Probab=26.08  E-value=2.5e+02  Score=25.76  Aligned_cols=64  Identities=23%  Similarity=0.244  Sum_probs=43.3

Q ss_pred             cHHHHHHHHhhhCCCCCCCCCC------chHHHHHHHHhhhhhhhHHHHHHHhc-------CCCceeecceeeeCCC
Q 016837          209 NYQELRRHARRVHPTTRPSDID------PSRERAWRRLEHQREYSDIVSAIRSS-------MPGAVVVGDYVIENGD  272 (381)
Q Consensus       209 tY~ELRKHaR~~HP~aRPseVD------P~Rqr~W~rLE~erE~~DvlStI~S~-------~PgavV~GDYVIE~gd  272 (381)
                      ||.-|--.|..--....|..-|      ++-......--+.|=+.-|.+-|-..       -||-+.+|||.||.-+
T Consensus        39 Ngs~LL~~A~AQN~~~dp~~~~~~~~~~~S~l~~F~~sLqsqlls~l~~~i~~~~fGe~~~~~Gt~~~gdf~I~i~~  115 (142)
T PF10614_consen   39 NGSWLLSSAQAQNDFKDPSAEDDFSTSSLSALDRFTQSLQSQLLSQLSRDITQGIFGEDPQKPGTFTTGDFTIEIVN  115 (142)
T ss_pred             cHHHHhhhhhhcCCcCCCccccccccCCCCHHHHHHHHHHHHHHHHHHHHHHhccccCCCCCCceEEECCEEEEEEe
Confidence            4777888888877778887763      22333333322334566666666666       7999999999999644


No 35 
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=25.29  E-value=21  Score=26.18  Aligned_cols=16  Identities=44%  Similarity=1.167  Sum_probs=6.6

Q ss_pred             CccccCC--Ccc-hhhhhc
Q 016837           52 CPICMDH--PHN-AVLLIC   67 (381)
Q Consensus        52 CPICME~--PHN-AVLLlC   67 (381)
                      ||||.|+  +.| .|+|.|
T Consensus         1 CpIc~e~~~~~n~P~~L~C   19 (43)
T PF13445_consen    1 CPICKEFSTEENPPMVLPC   19 (43)
T ss_dssp             -TTT----TTSS-EEE-SS
T ss_pred             CCccccccCCCCCCEEEeC
Confidence            8999994  222 466665


No 36 
>COG2879 Uncharacterized small protein [Function unknown]
Probab=24.93  E-value=93  Score=25.42  Aligned_cols=31  Identities=32%  Similarity=0.521  Sum_probs=25.7

Q ss_pred             cHHHHHHHHhhhCCCCCCCCCCchHHHHHHHHhhhhhhhHH
Q 016837          209 NYQELRRHARRVHPTTRPSDIDPSRERAWRRLEHQREYSDI  249 (381)
Q Consensus       209 tY~ELRKHaR~~HP~aRPseVDP~Rqr~W~rLE~erE~~Dv  249 (381)
                      .|.---.|+|.+||..-|.-          ..|..||.+|.
T Consensus        24 dYdnYVehmr~~hPd~p~mT----------~~EFfrec~da   54 (65)
T COG2879          24 DYDNYVEHMRKKHPDKPPMT----------YEEFFRECQDA   54 (65)
T ss_pred             cHHHHHHHHHHhCcCCCccc----------HHHHHHHHHHh
Confidence            67888899999999998875          67788888774


No 37 
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription]
Probab=23.74  E-value=48  Score=31.11  Aligned_cols=47  Identities=19%  Similarity=0.210  Sum_probs=39.5

Q ss_pred             chHHHhhcccCCCCcccCCcccccHHHHHHHHhhhCC-CCCCCCCCchHHH
Q 016837          186 EEARKYLNLKRRTCSRESCSFVGNYQELRRHARRVHP-TTRPSDIDPSRER  235 (381)
Q Consensus       186 e~AR~yLN~KkRSCs~E~CsF~GtY~ELRKHaR~~HP-~aRPseVDP~Rqr  235 (381)
                      ...|...|++   +-+--..+..-|.+||+|+=.+++ ..|-++||..|..
T Consensus       107 ~~~~~~~n~R---ER~Rv~~vN~~f~~Lr~~lP~~~~~~kklSKveTLr~A  154 (228)
T KOG4029|consen  107 SAQRQARNAR---ERQRVQSVNSAFAELRALLPTEPPQSKKLSKVETLRLA  154 (228)
T ss_pred             hhhhhhhhhh---hhhcccchhhhhHHHHhcCCCCCCcccccCcccchHHH
Confidence            4556777877   445556999999999999999999 9999999999865


No 38 
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]
Probab=22.92  E-value=33  Score=36.79  Aligned_cols=37  Identities=24%  Similarity=0.741  Sum_probs=29.0

Q ss_pred             ccccCccccCCCcchhhhhccccCCCCcccccCCCCccchhHHHHH
Q 016837           48 DEISCPICMDHPHNAVLLICSSHDKGCRSYICDTSYRHSNCLDRYK   93 (381)
Q Consensus        48 edatCPICME~PHNAVLLlCSSh~KGCRPYMCdTSyRHSNCLDQFk   93 (381)
                      |--|||||+|.=--        --.|=+|-+|+-||+|+ ||-++.
T Consensus       174 ELPTCpVCLERMD~--------s~~gi~t~~c~Hsfh~~-cl~~w~  210 (493)
T KOG0804|consen  174 ELPTCPVCLERMDS--------STTGILTILCNHSFHCS-CLMKWW  210 (493)
T ss_pred             cCCCcchhHhhcCc--------cccceeeeecccccchH-HHhhcc
Confidence            55799999998654        34788999999999765 876653


No 39 
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=22.02  E-value=36  Score=25.72  Aligned_cols=21  Identities=24%  Similarity=0.574  Sum_probs=17.9

Q ss_pred             ccccCccccccccceEEcchH
Q 016837          168 LSLKCPMCRGAILGWEVVEEA  188 (381)
Q Consensus       168 ~~L~CPLCRG~VkGWtVVe~A  188 (381)
                      ..+.|.-|.+.+.+|...+..
T Consensus        33 d~v~C~~C~~~~~~w~~~d~p   53 (69)
T cd00022          33 DEVKCFFCGLELKNWEPGDDP   53 (69)
T ss_pred             CEEEeCCCCCCccCCCCCCCH
Confidence            459999999999999988654


No 40 
>KOG0754 consensus Mitochondrial oxodicarboxylate carrier protein [Energy production and conversion]
Probab=21.63  E-value=60  Score=32.83  Aligned_cols=33  Identities=30%  Similarity=0.430  Sum_probs=28.5

Q ss_pred             cccccCccccCCCcchhhhhccccCCCCcccccCCCCccchhHHHHHHhhcCCC
Q 016837           47 LDEISCPICMDHPHNAVLLICSSHDKGCRSYICDTSYRHSNCLDRYKKLRTSSR  100 (381)
Q Consensus        47 WedatCPICME~PHNAVLLlCSSh~KGCRPYMCdTSyRHSNCLDQFkKa~~~~~  100 (381)
                      |+.+.=|||||-|-.|+=.+                     |.|||||.+.-..
T Consensus        69 ykGI~pPIl~EtPKRa~KF~---------------------~~eq~K~~F~~~~  101 (294)
T KOG0754|consen   69 YKGILPPILMETPKRATKFL---------------------TNEQYKKLFQFGN  101 (294)
T ss_pred             hccCCCHHhhhcchhhhhhc---------------------cHHHHHHHhcCCC
Confidence            99999999999999998443                     5799999998743


Done!