Citrus Sinensis ID: 016857

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-

MLGGLYGDLPPPSDEDKPTNTTTTVWSSSAKMAPPTLRKPSSIFAPPQTILKPQSKPKTTQNSLPTRPHSSPAIAPSPDDAAALPQPALVGVTSTVIEEYDPARPNDYEDYRREKKKKAVDAEIRRELERRRQEGEERERREREERENASASRLNMSGEEAWKRRAAMSSGGVPPRSPSPPPVNVESGGGGGGFTIGKSETSGLGLGAGGQMTAAQRMMAKMGWKEGQGLGRQEQGITTPLMARKTDRRAGVIVNASENKSEKKVKSVNFNGPPTRVLLLRNMVGPGEVDDELEDEVGSECAKYGTVTRVLIFEITEPNFPVDEAVRIFVQFERSEQTTKALIDLDGRFFGGRVVRATFYDEERFSKNELAPLPGEIPGFT

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHcccccccccccccccccHHHHcccccccccccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEEEEEcccccccccccEEEEEEcccHHHHHHHHHHHccccccccEEEEEEccHHHHcccccccccccccccc

*LGGLYGDL********************************************************************************VGVTSTVIEEYDPARPNDYED*******************************************************************************************************AAQRMM****************************************************GPPTRVLLLRNMVGPGEVDDELEDEVGSECAKYGTVTRVLIFEITEPNFPVDEAVRIFVQFERSEQTTKALIDLDGRFFGGRVVRATFYDEERFSKNELAPLPGE*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLGGLYGDLPPPSDEDKPTNTTTTVWSSSAKMAPPTLRKPSSIFAPPQTILKPQSKPKTTQNSLPTRPHSSPAIAPSPDDAAALPQPALVGVTSTVIEEYDPARPNDYEDYRREKKKKAVDAEIxxxxxxxxxxxxxxxxxxxxxRENASASRLNMSGEEAWKRRAAMSSGGVPPRSPSPPPVNVESGGGGGGFTIGKSETSGLGLGAGGQMTAAQRMMAKMGWKEGQGLGRQEQGITTPLMARKTDRRAGVIVNASENKSEKKVKSVNFNGPPTRVLLLRNMVGPGEVDDELEDEVGSECAKYGTVTRVLIFEITEPNFPVDEAVRIFVQFERSEQTTKALIDLDGRFFGGRVVRATFYDEERFSKNELAPLPGEIPGFT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA-damage-repair/toleration protein DRT111, chloroplastic	Seems to be involved in the resistance to UV light and chemical DNA-damaging agents.	confident	P42698
Splicing factor 45	Splice factor that binds to the single stranded 3'AG at the exon/intron border and promotes its utilization in the second catalytic step. Involved in the regulation of alternative splicing and the utilization of cryptic splice sites. Promotes the utilization of a cryptic splice site created by the beta-110 mutation in the HBB gene. The resulting frameshift leads to sickle cell anemia.	probable	Q96I25
Splicing factor 45	Splice factor that binds to the single stranded 3'AG at the exon/intron border and promotes its utilization in the second catalytic step. Involved in the regulation of alternative splicing and the utilization of cryptic splice sites.	probable	Q8JZX4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PE8, chain A
Confidence level:very confident
Coverage over the Query: 270-373
View the alignment between query and template
View the model in PyMOL