Citrus Sinensis ID: 016861


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
MEEGKYAKELDVAVRVVHMACSLCQRVQQKLVSSSDDGHVKSKDDDSPVTVADWSVQATVSLMLSETLVENLSIVAEEDVQTLTKADSEGLLAAVVNTVNECLAEAPKFGLQSPPGALGTSQILEAISRCSSNGGPAGRYWVLDPVDGTLGFVRGDQYAVALALIEDGKVVLGVLGCPNYPLKKELLNYPQNYNQTKSKTSLSTTATWEKGCVMYARRDGGGAWMQPLIHGDRMLEWPNSATQIWVSPIVDPALATVCEPVERANSNHSFTSGLAETVGLRTQPMRVHSMVKYAAIARGDAEIFMKFARAGYKEKIWDHAAGVIIIEEAGGVVTDAGGRPLDFSRGVFLENLDRGIIACSNAILHEKIVDAVYASWDSSNL
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEcccHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccEEEEccccccccccccccEEEEEEEEEccEEEEEEEEcccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccEEEEcccccccccEEEEECccccccccHHHHHHHHcccccccCEEccHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHcccEEEccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHcccc
***GKYA*ELDVAVRVVHMACSLCQRVQQKLV**************SPVTVADWSVQATVSLMLSETLVENLSIVAEEDVQTLTKADSEGLLAAVVNTVNECLAEAPKFGLQSPPGALGTSQILEAISRCSSNGGPAGRYWVLDPVDGTLGFVRGDQYAVALALIEDGKVVLGVLGCPNYPLKKELLNYPQNYNQTKSKTSLSTTATWEKGCVMYARRDGGGAWMQPLIHGDRMLEWPNSATQIWVSPIVDPALATVCEPVERANSNHSFTSGLAETVGLRTQPMRVHSMVKYAAIARGDAEIFMKFARAGYKEKIWDHAAGVIIIEEAGGVVTDAGGRPLDFSRGVFLENLDRGIIACSNAILHEKIVDAVYASW*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEGKYAKELDVAVRVVHMACSLCQRVQQKLVSSSDDGHVKSKDDDSPVTVADWSVQATVSLMLSETLVENLSIVAEEDVQTLTKADSEGLLAAVVNTVNECLAEAPKFGLQSPPGALGTSQILEAISRCSSNGGPAGRYWVLDPVDGTLGFVRGDQYAVALALIEDGKVVLGVLGCPNYPLKKELLNYPQNYNQTKSKTSLSTTATWEKGCVMYARRDGGGAWMQPLIHGDRMLEWPNSATQIWVSPIVDPALATVCEPVERANSNHSFTSGLAETVGLRTQPMRVHSMVKYAAIARGDAEIFMKFARAGYKEKIWDHAAGVIIIEEAGGVVTDAGGRPLDFSRGVFLENLDRGIIACSNAILHEKIVDAVYASWDSSNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PAP-specific phosphatase HAL2-like Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. May regulate the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS (By similarity). Prevents both the toxicity of PAP on RNA processing enzymes as well as the product inhibition by PAP of sulfate conjugation.probableQ38945
3'(2'),5'-bisphosphate nucleotidase Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Regulates the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS. Involved in salt tolerance. Confers resistance to lithium.probableP32179
3'(2'),5'-bisphosphate nucleotidase Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Regulates the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS. Is also able to hydrolyze inositol 1,4-bisphosphate and inositol 1,3,4-trisphosphate.probableQ55F34

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.73'(2'),5'-bisphosphate nucleotidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P3N, chain A
Confidence level:very confident
Coverage over the Query: 8-82,136-183,211-366
View the alignment between query and template
View the model in PyMOL
Template: 1LBV, chain A
Confidence level:very confident
Coverage over the Query: 5-82,135-183,211-269,282-372
View the alignment between query and template
View the model in PyMOL
Template: 1KA1, chain A
Confidence level:very confident
Coverage over the Query: 5-379
View the alignment between query and template
View the model in PyMOL
Template: 1QGX, chain A
Confidence level:confident
Coverage over the Query: 8-196,211-369
View the alignment between query and template
View the model in PyMOL