Citrus Sinensis ID: 016865


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
MKIVRHPNIVRLHEVLASRTKVYIILEFVTGGELFDKIVHQGRLLENDCRRYFQQLIDAVAHCHSKGVYHRDLKPENLLLDSYGNLKVSDFGLSALPQQGVELLHTTCGTPNYVAPEVLSNRGYDGSAADVWSCGVILFVLMAGYLPFGETDLPTLYKKINAAEFSCPFWFSTGATSLIHKILDPNPKTRIRIEGIRKHPWFRKNYNPVKCSEEEEVNLDDVHAVFDDIEDQYVAEQSENKVGGPLLMNAFEMITLSQGLNLAALFDRRQDYVKRQTRFVSRQPAQVILSNIEAVAESLSLKVHTRNYKTRLEGVSANKTGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLENIIWKPTEGSSLLRTMSC
ccccccccEEEEEEEEEcccEEEEEEEEccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEECccccccccccccccEEcccccccccccHHccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccHHHHHccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccHHHHHHHccccccccccccccccccccccEEccccHHHHHHHHHHHHHHcccEEEEEccEEEEEEccccccccEEEEEEEEEEEccEEEEEEEEccccHHHHHHHHHHHHHHcccccccccccccccccccc
MKIVRHPNIVRLHEVLASRTKVYIILEFVTGGELFDKIVHQGRLLENDCRRYFQQLIDAVAHCHSKGVYHRDLKPENLLLDSYGNLKVSDFGLSALPQQGVELLHTTCGTPNYVAPEVLSNRGYDGSAADVWSCGVILFVLMAGYLPFGETDLPTLYKKINAAEFSCPFWFSTGATSLIHKILDPNPKTRIRIEGIRKHPWFRKNYNPVK*********DDVHAVF*****************GPLLMNAFEMITLSQGLNLAALFDRRQDYVKRQTRFVSRQPAQVILSNIEAVAESLSLKVHTRNYKTRLEGVSANKTGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLENIIWKP************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIVRHPNIVRLHEVLASRTKVYIILEFVTGGELFDKIVHQGRLLENDCRRYFQQLIDAVAHCHSKGVYHRDLKPENLLLDSYGNLKVSDFGLSALPQQGVELLHTTCGTPNYVAPEVLSNRGYDGSAADVWSCGVILFVLMAGYLPFGETDLPTLYKKINAAEFSCPFWFSTGATSLIHKILDPNPKTRIRIEGIRKHPWFRKNYNPVKCSEEEEVNLDDVHAVFDDIEDQYVAEQSENKVGGPLLMNAFEMITLSQGLNLAALFDRRQDYVKRQTRFVSRQPAQVILSNIEAVAESLSLKVHTRNYKTRLEGVSANKTGQFAVVLEVFEVAPSLFMVDVRKAAGDTLEYHKFYKNFCAKLENIIWKPTEGSSLLRTMSC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CBL-interacting serine/threonine-protein kinase 24 Involved in the regulatory pathway for the control of intracellular Na(+) and K(+) homeostasis and salt tolerance. Activates the vacuolar H(+)/Ca(2+) antiporter CAX1 and operates in synergy with CBL4/SOS3 to activate the plasma membrane Na(+)/H(+) antiporter SOS1. CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner.confidentQ9LDI3
CBL-interacting protein kinase 24 Involved in the regulatory pathway for the control of intracellular Na(+) and K(+) homeostasis and salt tolerance. Operates in synergy with CBL4 to activate the plasma membrane Na(+)/H(+) antiporter SOS1. CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner.confidentQ69Q47

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EHB, chain D
Confidence level:very confident
Coverage over the Query: 244-368
View the alignment between query and template
View the model in PyMOL
Template: 3FE3, chain A
Confidence level:very confident
Coverage over the Query: 1-206
View the alignment between query and template
View the model in PyMOL
Template: 2Y94, chain A
Confidence level:very confident
Coverage over the Query: 1-347
View the alignment between query and template
View the model in PyMOL