Citrus Sinensis ID: 016871


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
MGQSLKIRVKTGTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRPSKPLKVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSAP
ccccccccccccccccccccEEEEccccccccccccHHHHHHHHccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccCEEEcccccEEccccEEEccccHHHHHHHHHHccccccccccccEEEEcccccccccccccccccccccHHHHHHHcccccccHHHHHHHHccccHHHHccccHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccEEEccccEEEEEEcccccEEEEEEccccEEEccEEEEccccHHHHHcccccccccHHHHHHcccccccEEEEEEEEccccccccccCECccccc
***********GTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYL*************LKVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSR***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQSLKIRVKTGTRKGFCPSKVVCVDYPRPDIDNTSNFLEAAYLSSSFRTSPRPSKPLKVVIAGAGLAGLSTAKYLADAGHKPLLLEARDVLGGKIAAWKDGDGDWYETGLHIFFGAYPNIQNLFGELGINDRLQWKEHSMIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phytoene dehydrogenase, chloroplastic/chromoplastic This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene.probableP28553
Phytoene dehydrogenase, chloroplastic/chromoplastic This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene.probableQ0DUI8
15-cis-phytoene desaturase, chloroplastic/chromoplastic This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene. The zeta-carotene produced has a central C15-C15' double bond in the cis configuration and it requires isomerization before being recognized as substrate by ZDS, the next enzyme in the lycopene biosynthesis pathway.probableQ07356

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YG5, chain A
Confidence level:very confident
Coverage over the Query: 57-371
View the alignment between query and template
View the model in PyMOL
Template: 3NKS, chain A
Confidence level:very confident
Coverage over the Query: 57-377
View the alignment between query and template
View the model in PyMOL
Template: 3K30, chain A
Confidence level:confident
Coverage over the Query: 8-98
View the alignment between query and template
View the model in PyMOL