BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016873
         (381 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IZ6|S Chain S, Localization Of The Small Subunit Ribosomal Proteins Into
           A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s
           Ribosome
          Length = 146

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 5/68 (7%)

Query: 57  CHMSSNGYMITFGIIEVL----FSQIPDFDQVWWLSIVAAIMSFTYSTAGLGL-GIGKVA 111
            H+  +G M     ++++    F ++P +D  W+ +  A+I    Y   G+G+ G  K+ 
Sbjct: 23  AHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRAASIARKIYLRQGIGVGGFQKIY 82

Query: 112 GNRSFKGS 119
           G R   GS
Sbjct: 83  GGRQRNGS 90


>pdb|4DNG|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From
           Bacillus Subtilis Subsp. Subtilis Str. 168
 pdb|4DNG|B Chain B, Crystal Structure Of Putative Aldehyde Dehydrogenase From
           Bacillus Subtilis Subsp. Subtilis Str. 168
          Length = 485

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 69  GIIEVLFSQIPDFDQVWWLSIVAAIMSFTYSTAGLGLGIGKVAGNRSFK 117
           G++ V+ + + +       + +  ++SFT STA +G  IG++AG R+FK
Sbjct: 202 GVLNVMLTDVKEIGDGMLTNPIPRLISFTGSTA-VGRHIGEIAG-RAFK 248


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.141    0.445 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,917,387
Number of Sequences: 62578
Number of extensions: 440128
Number of successful extensions: 1067
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 1067
Number of HSP's gapped (non-prelim): 9
length of query: 381
length of database: 14,973,337
effective HSP length: 101
effective length of query: 280
effective length of database: 8,652,959
effective search space: 2422828520
effective search space used: 2422828520
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)