BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016881
         (381 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1VBF|A Chain A, Crystal Structure Of Protein L-Isoaspartate
           O-Methyltransferase Homologue From Sulfolobus Tokodaii
 pdb|1VBF|B Chain B, Crystal Structure Of Protein L-Isoaspartate
           O-Methyltransferase Homologue From Sulfolobus Tokodaii
 pdb|1VBF|C Chain C, Crystal Structure Of Protein L-Isoaspartate
           O-Methyltransferase Homologue From Sulfolobus Tokodaii
 pdb|1VBF|D Chain D, Crystal Structure Of Protein L-Isoaspartate
           O-Methyltransferase Homologue From Sulfolobus Tokodaii
          Length = 231

 Score = 27.7 bits (60), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%)

Query: 258 LAVPIGSVGKWCNSLWNSYEKALKGQKELMSTMQIGAYVKIMDMDHIRVLVNKLEIQIEA 317
           L + +G V K    +      +L+   E+      G Y    D D I   VNKLE QI++
Sbjct: 163 LPIGVGRVQKLYKVIKKGNSPSLENLGEVXFGRIGGLYGFYDDYDDIEFRVNKLERQIKS 222

Query: 318 LLNN 321
           +L+N
Sbjct: 223 ILDN 226


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.135    0.387 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,150,801
Number of Sequences: 62578
Number of extensions: 262166
Number of successful extensions: 718
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 717
Number of HSP's gapped (non-prelim): 1
length of query: 381
length of database: 14,973,337
effective HSP length: 101
effective length of query: 280
effective length of database: 8,652,959
effective search space: 2422828520
effective search space used: 2422828520
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)