BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016881
(381 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1VBF|A Chain A, Crystal Structure Of Protein L-Isoaspartate
O-Methyltransferase Homologue From Sulfolobus Tokodaii
pdb|1VBF|B Chain B, Crystal Structure Of Protein L-Isoaspartate
O-Methyltransferase Homologue From Sulfolobus Tokodaii
pdb|1VBF|C Chain C, Crystal Structure Of Protein L-Isoaspartate
O-Methyltransferase Homologue From Sulfolobus Tokodaii
pdb|1VBF|D Chain D, Crystal Structure Of Protein L-Isoaspartate
O-Methyltransferase Homologue From Sulfolobus Tokodaii
Length = 231
Score = 27.7 bits (60), Expect = 10.0, Method: Compositional matrix adjust.
Identities = 20/64 (31%), Positives = 30/64 (46%)
Query: 258 LAVPIGSVGKWCNSLWNSYEKALKGQKELMSTMQIGAYVKIMDMDHIRVLVNKLEIQIEA 317
L + +G V K + +L+ E+ G Y D D I VNKLE QI++
Sbjct: 163 LPIGVGRVQKLYKVIKKGNSPSLENLGEVXFGRIGGLYGFYDDYDDIEFRVNKLERQIKS 222
Query: 318 LLNN 321
+L+N
Sbjct: 223 ILDN 226
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.135 0.387
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,150,801
Number of Sequences: 62578
Number of extensions: 262166
Number of successful extensions: 718
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 717
Number of HSP's gapped (non-prelim): 1
length of query: 381
length of database: 14,973,337
effective HSP length: 101
effective length of query: 280
effective length of database: 8,652,959
effective search space: 2422828520
effective search space used: 2422828520
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)