BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016918
(380 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4GAG|H Chain H, Structure Of The Broadly Neutralizing Antibody Ap33 In
Complex With Its Hcv Epitope (E2 Residues 412-423)
pdb|4GAJ|H Chain H, Structure Of The Broadly Neutralizing Antibody Ap33 In
Complex With Its Hcv Epitope (E2 Residues 411-424)
pdb|4GAY|H Chain H, Structure Of The Broadly Neutralizing Antibody Ap33
pdb|4GAY|A Chain A, Structure Of The Broadly Neutralizing Antibody Ap33
Length = 218
Score = 30.0 bits (66), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 15/54 (27%), Positives = 22/54 (40%)
Query: 189 SICKSKWDKCPSFPAGEYEYIDVIVKGETLLVDIDFRSEFEIARSTGAYKAILQ 242
SI W+ FP + EY+ I + ++ RS I R T + LQ
Sbjct: 28 SITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQ 81
>pdb|4G6A|C Chain C, Structure Of The Hepatitis C Virus Envelope Glycoprotein
E2 Antigenic Region 412-423 Bound To The Broadly
Neutralizing Antibody Ap33
pdb|4G6A|H Chain H, Structure Of The Hepatitis C Virus Envelope Glycoprotein
E2 Antigenic Region 412-423 Bound To The Broadly
Neutralizing Antibody Ap33
Length = 224
Score = 30.0 bits (66), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 15/54 (27%), Positives = 22/54 (40%)
Query: 189 SICKSKWDKCPSFPAGEYEYIDVIVKGETLLVDIDFRSEFEIARSTGAYKAILQ 242
SI W+ FP + EY+ I + ++ RS I R T + LQ
Sbjct: 29 SITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQ 82
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.132 0.382
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,052,313
Number of Sequences: 62578
Number of extensions: 377308
Number of successful extensions: 775
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 773
Number of HSP's gapped (non-prelim): 3
length of query: 380
length of database: 14,973,337
effective HSP length: 101
effective length of query: 279
effective length of database: 8,652,959
effective search space: 2414175561
effective search space used: 2414175561
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)