Citrus Sinensis ID: 016938


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380
MSVTLAAIFGAAAGAVALMGIIFFLSWFCLYRNRSVSRTSETGSSEPSVQPGRNVGIELSIREARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGSHLFRATK
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEEccccEEEEEEccccccHHHHHHHHHHHcccccccccEEEEEccccEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccccccCCcccccccccc
**VTLAAIFGAAAGAVALMGIIFFLSWFC************************************RFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREAS******S**DLVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRT*****************************
xxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVTLAAIFGAAAGAVALMGIIFFLSWFCLYRNRSVSRTSETGSSEPSVQPGRNVGIELSIREARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGSHLFRATK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 63-350
View the alignment between query and template
View the model in PyMOL
Template: 3PP0, chain A
Confidence level:probable
Coverage over the Query: 83-283,297-365
View the alignment between query and template
View the model in PyMOL
Template: 3LVP, chain A
Confidence level:probable
Coverage over the Query: 62-274
View the alignment between query and template
View the model in PyMOL
Template: 2JWA, chain A
Confidence level:probable
Coverage over the Query: 4-34
View the alignment between query and template
View the model in PyMOL