Citrus Sinensis ID: 016955


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380
MSSLNDCNDADNMVLVEEGASSRTIILNRPNVLNALLTPMGVRMTKLYESWEKDSRVGFVVIKGNGRSFCAGGDVVTLYRLLSKGRVEECKECFRTFYSLMYRLNTYLKPHVAIMNGITMGGGAGLSVHGSFCIATEKTVFAIPEVLIGSHPDAGASYYLSHLPGHLGEYLGLTGGRLSGEELLACGFATHYIPSARLPLIEEQLRTLAVHDFSAMETFLAKHSEHVYPNENSILHRVETLNKCFGHDTVEEIIGALESEVAETNDEWCLSTLKKLREAPPLSLKISLKSIQKARFETLEECLKREYRMSMRMISRQISNDFCEGVRTRLVEKSFAPKWDPPCLEQVTEEMVNAYFERISVDEPELELPNKLRKASHANV
cccccccccccccEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccEEEEEccEEEcccccccccccEEEEcccccccccccccccccccccHHHccccccccHHHHHcccccccHHHHHHccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccHHcEEEEcccccccccccccccccHHHHHHcccccccccccccccccccccccccc
*************VLVEEGASSRTIILNRPNVLNALLTPMGVRMTKLYESWEKDSRVGFVVIKGNGRSFCAGGDVVTLYRLLSKGRVEECKECFRTFYSLMYRLNTYLKPHVAIMNGITMGGGAGLSVHGSFCIATEKTVFAIPEVLIGSHPDAGASYYLSHLPGHLGEYLGLTGGRLSGEELLACGFATHYIPSARLPLIEEQLRTLAVHDFSAMETFLAKHSEHVYPNENSILHRVETLNKCFGHDTVEEIIGALESEVAETNDEWCLSTLKKLREAPPLSLKISLKSIQKARFETLEECLKREYRMSMRMISRQISNDFCEGVRTRLVEKSFAPKWDPPCLEQVTEEMVNAYFERISVDEPELEL************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLNDCNDADNMVLVEEGASSRTIILNRPNVLNALLTPMGVRMTKLYESWEKDSRVGFVVIKGNGRSFCAGGDVVTLYRLLSKGRVEECKECFRTFYSLMYRLNTYLKPHVAIMNGITMGGGAGLSVHGSFCIATEKTVFAIPEVLIGSHPDAGASYYLSHLPGHLGEYLGLTGGRLSGEELLACGFATHYIPSARLPLIEEQLRTLAVHDFSAMETFLAKHSEHVYPNENSILHRVETLNKCFGxxxxxxxxxxxxxxxxxxxxxWCLSTLKKLREAPPLSLKISLKSIQKARFETLEECLKREYRMSMRMISRQISNDFCEGVRTRLVEKSFAPKWDPPCLEQVTEEMVNAYFERISVDEPELELPNKLRKASHANV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial probableQ5XF59
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Hydrolyzes 3-hydroxyisobutyryl-CoA (HIBYL-CoA), a saline catabolite. Has high activity toward isobutyryl-CoA. Could be an isobutyryl-CoA dehydrogenase that functions in valine catabolism. Also hydrolyzes 3-hydroxypropanoyl-CoA.probableQ5XIE6
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Hydrolyzes 3-hydroxyisobutyryl-CoA (HIBYL-CoA), a saline catabolite. Has high activity toward isobutyryl-CoA. Could be an isobutyryl-CoA dehydrogenase that functions in valine catabolism. Also hydrolyzes 3-hydroxypropanoyl-CoA.probableQ6NVY1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.2.-Thiolester hydrolases.probable
3.1.2.43-hydroxyisobutyryl-CoA hydrolase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BPT, chain A
Confidence level:very confident
Coverage over the Query: 9-372
View the alignment between query and template
View the model in PyMOL