Query         016956
Match_columns 380
No_of_seqs    230 out of 1151
Neff          5.6 
Searched_HMMs 46136
Date          Fri Mar 29 04:20:45 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/016956.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/016956hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03114 ADP-ribosylation fact 100.0   6E-94 1.3E-98  700.5  28.3  363    1-372    24-394 (395)
  2 KOG0706 Predicted GTPase-activ 100.0 1.5E-82 3.2E-87  633.5  24.3  370    1-380    25-454 (454)
  3 KOG0704 ADP-ribosylation facto 100.0 6.1E-36 1.3E-40  291.5   7.6  100    1-100    21-121 (386)
  4 COG5347 GTPase-activating prot 100.0 1.2E-33 2.7E-38  277.9   8.8  102    1-102    22-124 (319)
  5 KOG0703 Predicted GTPase-activ 100.0   4E-31 8.7E-36  254.7   3.5   88    1-88     27-124 (287)
  6 smart00105 ArfGap Putative GTP 100.0   4E-30 8.7E-35  218.6   8.0   93    1-93      5-102 (112)
  7 PF01412 ArfGap:  Putative GTPa 100.0 4.5E-30 9.8E-35  219.4   4.3   70    1-70     15-84  (116)
  8 PLN03131 hypothetical protein;  99.9 8.3E-24 1.8E-28  218.9   6.3   82    1-86     25-120 (705)
  9 PLN03119 putative ADP-ribosyla  99.9 7.7E-24 1.7E-28  217.7   5.9   83    1-86     25-120 (648)
 10 KOG0705 GTPase-activating prot  99.8 1.2E-20 2.6E-25  194.0   6.7   86    1-86    515-612 (749)
 11 KOG0521 Putative GTPase activa  99.7 7.5E-19 1.6E-23  190.8   1.0   85    1-85    428-526 (785)
 12 KOG0818 GTPase-activating prot  99.7 2.2E-17 4.9E-22  167.8   2.2   86    1-86     10-115 (669)
 13 KOG1117 Rho- and Arf-GTPase ac  99.5 9.9E-15 2.2E-19  155.7   1.5   86    1-86    300-399 (1186)
 14 KOG0702 Predicted GTPase-activ  98.4 9.9E-08 2.1E-12   98.2   3.1   68    1-69     27-95  (524)
 15 KOG0521 Putative GTPase activa  92.9   0.023 4.9E-07   63.3  -0.8   65    1-67    632-697 (785)
 16 PLN03114 ADP-ribosylation fact  87.8    0.89 1.9E-05   46.4   5.2   20  308-327   300-319 (395)
 17 KOG0706 Predicted GTPase-activ  86.9     1.6 3.4E-05   45.6   6.5   75  270-371   378-452 (454)
 18 PRK00085 recO DNA repair prote  79.0     1.3 2.8E-05   41.9   2.2   28    1-28    151-179 (247)
 19 TIGR00613 reco DNA repair prot  66.1     3.6 7.8E-05   38.8   1.8   28    1-28    149-177 (241)
 20 PF00320 GATA:  GATA zinc finge  62.4     5.7 0.00012   27.1   1.8   32    2-33      1-34  (36)
 21 PF10764 Gin:  Inhibitor of sig  56.4     6.2 0.00013   28.7   1.2   26    1-27      1-26  (46)
 22 PF00643 zf-B_box:  B-box zinc   56.0     6.6 0.00014   27.0   1.2   31    1-31      5-36  (42)
 23 PF08271 TF_Zn_Ribbon:  TFIIB z  51.1     9.3  0.0002   26.8   1.4   25    1-26      2-26  (43)
 24 smart00401 ZnF_GATA zinc finge  48.2      15 0.00033   27.1   2.1   35    1-35      5-41  (52)
 25 COG1381 RecO Recombinational D  44.2      11 0.00024   36.5   1.1   26    1-26    156-182 (251)
 26 PRK12495 hypothetical protein;  41.8      13 0.00029   35.7   1.2   23    1-27     44-66  (226)
 27 COG1997 RPL43A Ribosomal prote  39.7      22 0.00047   29.5   2.0   25    1-27     37-61  (89)
 28 cd00202 ZnF_GATA Zinc finger D  38.6      18  0.0004   27.0   1.3   34    1-34      1-36  (54)
 29 smart00659 RPOLCX RNA polymera  37.6      13 0.00029   26.6   0.5   27    1-32      4-30  (44)
 30 PRK11019 hypothetical protein;  36.1       6 0.00013   32.7  -1.7   35    1-36     38-74  (88)
 31 PF01286 XPA_N:  XPA protein N-  32.7      14  0.0003   25.4  -0.1   26    1-26      5-31  (34)
 32 PHA00080 DksA-like zinc finger  32.6     9.6 0.00021   30.2  -1.0   29    1-30     33-63  (72)
 33 PF11781 RRN7:  RNA polymerase   31.7      33 0.00071   23.6   1.6   21    2-25     11-31  (36)
 34 cd07170 NR_DBD_ERR DNA-binding  30.1      26 0.00056   29.3   1.0   27    2-31      7-33  (97)
 35 PF03604 DNA_RNApol_7kD:  DNA d  30.1      13 0.00029   25.0  -0.6   22    1-25      2-23  (32)
 36 cd07162 NR_DBD_PXR DNA-binding  28.6      36 0.00078   27.7   1.6   28    1-31      1-28  (87)
 37 cd06968 NR_DBD_ROR DNA-binding  28.1      32 0.00068   28.6   1.2   27    2-31      8-34  (95)
 38 PF07282 OrfB_Zn_ribbon:  Putat  27.8      35 0.00077   25.9   1.4   24    1-26     30-53  (69)
 39 PF14376 Haem_bd:  Haem-binding  27.1      28 0.00062   30.6   0.9   13    1-13     43-55  (137)
 40 COG2174 RPL34A Ribosomal prote  26.4      31 0.00068   28.8   0.9   14   14-27     66-79  (93)
 41 PRK00423 tfb transcription ini  26.4      42 0.00092   33.4   2.0   28    1-29     13-40  (310)
 42 cd07157 2DBD_NR_DBD1 The first  26.3      27 0.00059   28.4   0.5   27    2-31      3-29  (86)
 43 PRK13715 conjugal transfer pro  25.2      14 0.00031   29.3  -1.3   31    1-31     36-67  (73)
 44 TIGR02419 C4_traR_proteo phage  24.7      16 0.00036   28.1  -1.0   28    1-29     33-62  (63)
 45 PF13119 DUF3973:  Domain of un  24.6      32 0.00069   24.4   0.5   13   20-32      2-14  (41)
 46 cd06965 NR_DBD_Ppar DNA-bindin  24.3      31 0.00067   27.9   0.5   27    2-31      2-28  (84)
 47 cd07165 NR_DBD_DmE78_like DNA-  24.2      39 0.00084   27.1   1.1   27    2-31      1-27  (81)
 48 smart00290 ZnF_UBP Ubiquitin C  23.7      54  0.0012   23.2   1.7   22    1-22      1-22  (50)
 49 COG2158 Uncharacterized protei  23.3      52  0.0011   28.3   1.6   32    2-35     45-78  (112)
 50 cd07160 NR_DBD_LXR DNA-binding  23.1      41 0.00089   28.3   1.0   27    2-31     21-47  (101)
 51 cd06966 NR_DBD_CAR DNA-binding  23.0      42 0.00091   27.8   1.1   28    1-31      2-29  (94)
 52 cd07171 NR_DBD_ER DNA-binding   22.7      43 0.00094   27.0   1.1   27    2-31      6-32  (82)
 53 cd07168 NR_DBD_DHR4_like DNA-b  22.6      44 0.00096   27.4   1.1   27    2-31      9-35  (90)
 54 PTZ00074 60S ribosomal protein  22.3      41 0.00089   30.0   0.9   25    1-25     43-84  (135)
 55 cd07156 NR_DBD_VDR_like The DN  22.2      52  0.0011   25.7   1.4   27    2-31      1-27  (72)
 56 PF04770 ZF-HD_dimer:  ZF-HD pr  22.1      38 0.00083   26.1   0.6   29    3-32     22-52  (60)
 57 cd07161 NR_DBD_EcR DNA-binding  21.7      51  0.0011   27.2   1.3   27    2-31      4-30  (91)
 58 cd07158 NR_DBD_Ppar_like The D  21.6      49  0.0011   25.8   1.2   27    2-31      1-27  (73)
 59 KOG3507 DNA-directed RNA polym  21.6      35 0.00076   26.3   0.3   27    1-32     22-48  (62)
 60 cd07169 NR_DBD_GCNF_like DNA-b  20.9      46   0.001   27.3   0.9   27    2-31      9-35  (90)
 61 cd07173 NR_DBD_AR DNA-binding   20.0      47   0.001   26.8   0.8   27    2-31      6-32  (82)

No 1  
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=100.00  E-value=6e-94  Score=700.53  Aligned_cols=363  Identities=70%  Similarity=1.024  Sum_probs=319.7

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhcCCCCCCchhh
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQHGWTDGGKIEA   80 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~~~~~~~~i~~   80 (380)
                      +|||||+++|+|+|++||||||++|+|+||.||+|||||||++||.|+++||++|+.|||.++++||++||+.....|++
T Consensus        24 ~CaDCga~nPtWASvn~GIFLCl~CSGVHRsLGvHISfVRSltLD~Ws~eqL~~Mk~GGN~rA~~fF~qhG~~~~~~~~~  103 (395)
T PLN03114         24 ICFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSSEQLKMMIYGGNNRAQVFFKQYGWSDGGKTEA  103 (395)
T ss_pred             cCccCCCCCCCceeeccceeehhhhhHhhccCCCCCceeecccCCCCCHHHHHHHHHhcCHHHHHHHHHcCCCCCCCccc
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999987678999


Q ss_pred             hhccHHHHHHHHHHHHHHHHHhhhcc-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CcCCCCCCCCCC-CCCCcccccc
Q 016956           81 KYTSRAAELYKQILAKEVAKNMAEEA-GLPSSPVASQPAQAANALPDVKIQDAPKE-NYQGRQETQDAP-GSPKVSRTVL  157 (380)
Q Consensus        81 KY~~~~a~~Yr~~l~~~v~~~~~~~~-~~~~~~~~~~~~~~~Dff~~~~~~~~p~~-~~~~~~~~~~~~-~~p~~~~~~~  157 (380)
                      ||.++++.+||++|+++|++.+.++. .+|+.++++  ...+|+|++.+..+.|.. ++++..+.+... .+|++     
T Consensus       104 KY~S~aA~~Yre~L~keVa~~~a~~~~~~p~~~~~~--~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~s~~~-----  176 (395)
T PLN03114        104 KYTSRAADLYKQILAKEVAKSKAEEELDLPPSPPDS--TQVPNGLSSIKTSEALKESNTLKQQEKPDVVPVSPRI-----  176 (395)
T ss_pred             ccCCHHHHHHHHHHHHHHHHhhhccccCCCCCCCCc--cccccCcccccccccccccCCcccccCCcccCCCCCC-----
Confidence            99999999999999999999998765 345555543  237899999888776643 234443333222 24543     


Q ss_pred             cccccCCCccccCCCCCCccccccCCCCCccccCCCCCCCCCCCCCCCCCC-CCCCCCcccchhchhhhcccccCCCCCC
Q 016956          158 TSTVKKPLGAKKSGKTGGLGARKLTSKPSESLYEQKPEEPSVPISSSTSNT-SSVSLPFASRFEYVDNVQSSELSSGGPQ  236 (380)
Q Consensus       158 s~~~kk~~~akk~~K~~~LgakKv~~~~~e~~~d~~~ee~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~  236 (380)
                      +++.|||+|+||.||+|||||+|++++..|.||||++|| .++.+++++.. +...++.++||.|.|+++. +...++..
T Consensus       177 ~~~~kk~~gak~~gktgglg~~klttk~~~~ly~qkp~e-~~~~~~~~~~~~~~~~~~~~srf~y~d~~~~-~~~~~~~~  254 (395)
T PLN03114        177 SRSVKKPLGAKKTGKTGGLGARKLTTKSSGTLYDQKPEE-SVIIQATSPVSAKSARSSFSSRFDYADNVQN-REDYMSPQ  254 (395)
T ss_pred             ccccccccccccccccCCccccccccCCchhhhhcCccc-cCCCCCCCccccccCCCCcchhhhhcccccc-ccccCCcc
Confidence            357899999999999999999999999999999999999 55555555443 3455677899999999998 66677789


Q ss_pred             cccccCCCCCCccc-ccCCCCcC-CCCCCC--CcccchhhhHHHHHHhccCCcCccccccCCCCCccchhHHHHhhhccC
Q 016956          237 VLSHVAPPKSSSFF-ADYGMDNG-FQKKSG--SSKVQIQETDEARKKFSNAKSISSSQFFGDQNNSIDMDTQVSLQKFSG  312 (380)
Q Consensus       237 ~~~~~~~~~~~~~~-~~~g~~~~-~~~~~~--~~~~~~~~t~~a~~KFgnaKaISSd~yFGr~~~~a~~ea~~rL~~F~g  312 (380)
                      ..+||+||++..|| .+|||+.+ +++++.  +.+.+++++++||+||||||+||||||||+++..+++|++.||++|+|
T Consensus       255 ~~~hvapp~ss~ff~~e~g~~~~~~~k~~~~~~~k~q~~e~~~a~kKF~naKsisS~qfFg~~~~~~d~~~~~~l~kf~g  334 (395)
T PLN03114        255 VVSHVAPPKSSGFFEEELEMNGGRFQKKPITSSSKLQIQETDEARKKFTNAKSISSAQYFGNDNNSADLEAKSSLKKFSG  334 (395)
T ss_pred             cccccCCCccchhhHHhhcCCcccccCCCCCccccccccchHHHHHHhcccccccHHhhccccccccchhhHHHHHhhcc
Confidence            99999999999999 68999998 888776  677899999999999999999999999999998889999999999999


Q ss_pred             CcccccccccCCCCCCcccchhhHHHHHHhhhchHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 016956          313 SASISSADLFGHDSDNASLDLAASDLINRLSFQAQQDISSLKNIAGETGKKLSSLASSLI  372 (380)
Q Consensus       313 atsISS~~yFg~~~~~~~~~~sA~dl~~~~~~~a~~Dl~~lk~~v~~~A~KLs~~a~~~~  372 (380)
                      +++|||+|||||++++.+++++|.||++||++||.+||+.||+++++++.||++||++++
T Consensus       335 s~~ISsad~fg~~~~d~~id~ta~dli~r~s~qa~qd~sslkn~aget~~kl~s~as~~~  394 (395)
T PLN03114        335 SSAISSADLFGDSDGDFTLDLTAGDLLNRLSLQAQQDISSLKNMAEETKKKLGSVASSLW  394 (395)
T ss_pred             ccccchHHhcCCCCccccccccHHHHHHHhhhhhHhHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            999999999999988889999999999999999999999999999999999999999875


No 2  
>KOG0706 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=100.00  E-value=1.5e-82  Score=633.51  Aligned_cols=370  Identities=47%  Similarity=0.673  Sum_probs=275.4

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhcCCCCCCchhh
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQHGWTDGGKIEA   80 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~~~~~~~~i~~   80 (380)
                      +|||||++||+|+||+|||||||+|+++||+||||||||||++||.|++.|||+|++|||.+|+.||.+|||.. .++++
T Consensus        25 vCFDCgAknPtWaSVTYGIFLCiDCSAvHRnLGVHiSFVRSTnLDsWs~~qLR~M~~GGN~nA~~FFkqhg~~t-~d~~a  103 (454)
T KOG0706|consen   25 VCFDCGAKNPTWASVTYGIFLCIDCSAVHRNLGVHISFVRSTNLDSWSWEQLRRMQVGGNANARVFFKQHGCVT-LDANA  103 (454)
T ss_pred             eecccCCCCCCceeecceEEEEEecchhhhccccceEEEeecccccCCHHHHhHhhhcCchhHHHHHHHcCCcc-hhhhh
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999987 69999


Q ss_pred             hhccHHHHHHHHHHHHHHHHHhhhcc---CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCcCCCCCCCCCCCCCCccccc
Q 016956           81 KYTSRAAELYKQILAKEVAKNMAEEA---GLPS-SPVASQPAQAANALPDVKIQDAPKENYQGRQETQDAPGSPKVSRTV  156 (380)
Q Consensus        81 KY~~~~a~~Yr~~l~~~v~~~~~~~~---~~~~-~~~~~~~~~~~Dff~~~~~~~~p~~~~~~~~~~~~~~~~p~~~~~~  156 (380)
                      ||.+|++++|+++|+++|.+.+.+++   .++. .++..++..+.|||+.+....+-........   ....+|+++.+.
T Consensus       104 KY~SraA~~Yr~kl~~lv~kam~~~~~~l~l~~~~~~~~~~~~~~dffs~~~k~~~~~~~s~~~l---~~~~s~~~S~~v  180 (454)
T KOG0706|consen  104 KYNSRAAKLYREKLKKLVQKAMAEHGTSLLLDSAVSSGSPESEDSDFFSESDKESSKHEPSTDAL---KSLSSPSASNTV  180 (454)
T ss_pred             hhccHHHHHHHHHHHHHHHHHHHhcCccccccCCCCCCCCccccccchhhccccccccCCccccc---ccccCCcccccc
Confidence            99999999999999999999998876   2333 2333345667899988755431100000000   111244445455


Q ss_pred             ccccccCCCccccCCCCCC--ccccccCCCCCccccCCCCCCCCCCCCCCCCCCCC-CCCCcccchhchh---hhc----
Q 016956          157 LTSTVKKPLGAKKSGKTGG--LGARKLTSKPSESLYEQKPEEPSVPISSSTSNTSS-VSLPFASRFEYVD---NVQ----  226 (380)
Q Consensus       157 ~s~~~kk~~~akk~~K~~~--LgakKv~~~~~e~~~d~~~ee~~~~~~~~~~~~~~-~~~~~~~~~~~~~---~~~----  226 (380)
                      .+...++|.++|++|++++  |||+||.++.+..++.+..+++.....+.++.... .....+.++.|++   +.+    
T Consensus       181 ~sg~~k~p~~~k~~g~~k~~~lgarkv~t~s~~~~~~~~~~~~~~~i~a~s~~~~s~~~~~~s~~~~~~e~~dd~~~~E~  260 (454)
T KOG0706|consen  181 VSGKKKPPVTKKGLGAKKGVTLGARKVNTKSFKSIESQAQEAEKNKIKAASPKPSSEESSARSSRLARQELQDDRKKEEA  260 (454)
T ss_pred             ccccccCCccccccccccccccCceecccccccchhhccchhhhccccccCCCcchhhhcccchhhhhhHHHHHHHhhhh
Confidence            5566677777777884444  99999999877777877766544333322222111 0111223333332   211    


Q ss_pred             ------------ccccCCCCCCccccc-----------CCCCCCcccccCCCCcC-------------CCCCCC------
Q 016956          227 ------------SSELSSGGPQVLSHV-----------APPKSSSFFADYGMDNG-------------FQKKSG------  264 (380)
Q Consensus       227 ------------~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~g~~~~-------------~~~~~~------  264 (380)
                                  ..+|| +.|+...|+           ++|+..++|..++|...             +.+...      
T Consensus       261 k~~d~~k~~~~~rlgmg-~~~s~~~hs~~~~~~~i~~~t~~~~k~~~~~~~~~~~~~~~~~s~~~~~~~~~~~ss~ss~~  339 (454)
T KOG0706|consen  261 KAKDGKKASSSERLGMG-GYRSVMSHSVLGGMQVIEQVTPPKAKPSFLELDMFSDTTKQSSSNYKDAPFGKGSSSSSSKD  339 (454)
T ss_pred             hhcCcccccchhhhccc-cccchhhhcccCCceeeecccCccccccccccccccchhccccCCcccCccccCcccccchh
Confidence                        12555 335555554           45554444444333221             111111      


Q ss_pred             ----CcccchhhhHHHHHHhccCCcCccccccCCCCCccchhHHHHhhhccCCcccccccccCCCCCCcccchhhHHHHH
Q 016956          265 ----SSKVQIQETDEARKKFSNAKSISSSQFFGDQNNSIDMDTQVSLQKFSGSASISSADLFGHDSDNASLDLAASDLIN  340 (380)
Q Consensus       265 ----~~~~~~~~t~~a~~KFgnaKaISSd~yFGr~~~~a~~ea~~rL~~F~gatsISS~~yFg~~~~~~~~~~sA~dl~~  340 (380)
                          ..+.++++|++||+||||||+|||||||||+. ++++|+|+||++|+|+++|||+||||++++    ..++.+++.
T Consensus       340 a~~~~~~~~v~~td~~rkkF~naKaISSdqyFG~~~-~ad~Ea~~~L~~f~gstaISSsd~fG~~~~----~~~~g~~~~  414 (454)
T KOG0706|consen  340 AKRAKESRPVEETDEARKKFGNAKAISSDQYFGRGS-EADLEARARLQKFSGSTAISSSDLFGEGDD----DHTAGSLAL  414 (454)
T ss_pred             hhccccccccccccHHHHhhccccccchhhhcCCcc-hhhhHHHHHHHhccCccccchHhhcCCCCC----CCCccchhh
Confidence                22246788999999999999999999999998 679999999999999999999999999876    356677788


Q ss_pred             HhhhchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcC
Q 016956          341 RLSFQAQQDISSLKNIAGETGKKLSSLASSLITDIQDRIL  380 (380)
Q Consensus       341 ~~~~~a~~Dl~~lk~~v~~~A~KLs~~a~~~~~~iQdry~  380 (380)
                      ++.+++.+||.+++++|+++|+||+++|++|+++|||||+
T Consensus       415 ~~~~~a~~di~~~k~~~~~~a~kls~~a~~v~~~~qd~~~  454 (454)
T KOG0706|consen  415 RDSFRAAQDIASFKNSARSVAGKLSVLASKVGSSLQDRYG  454 (454)
T ss_pred             cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            8889999999999999999999999999999999999995


No 3  
>KOG0704 consensus ADP-ribosylation factor GTPase activator [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]
Probab=100.00  E-value=6.1e-36  Score=291.54  Aligned_cols=100  Identities=49%  Similarity=0.930  Sum_probs=94.8

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhcCCCCCC-chh
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQHGWTDGG-KIE   79 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~~~~~~~-~i~   79 (380)
                      +||||+++||+|+||+||||||++|+|+||.|||||||||||+||+|.+.||+.|+.|||.++++||+.++..... .|+
T Consensus        21 ~CfeC~a~NPQWvSvsyGIfICLECSG~HRgLGVhiSFVRSVTMD~wkeiel~kMeaGGN~~~~eFL~s~~~~~e~~~i~  100 (386)
T KOG0704|consen   21 KCFECGAPNPQWVSVSYGIFICLECSGKHRGLGVHISFVRSVTMDKWKEIELKKMEAGGNERFREFLSSQGIYKETWPIR  100 (386)
T ss_pred             ceeecCCCCCCeEeecccEEEEEecCCcccccceeeEEEEeeecccccHHHHHHHHhccchhHHHHHhhCccccccccHH
Confidence            5999999999999999999999999999999999999999999999999999999999999999999999865544 899


Q ss_pred             hhhccHHHHHHHHHHHHHHHH
Q 016956           80 AKYTSRAAELYKQILAKEVAK  100 (380)
Q Consensus        80 ~KY~~~~a~~Yr~~l~~~v~~  100 (380)
                      +||.+++|.+||.+|...++-
T Consensus       101 eKYns~aAa~yRdki~~laeg  121 (386)
T KOG0704|consen  101 EKYNSRAAALYRDKIAALAEG  121 (386)
T ss_pred             HhhccHHHHHHHHHHHHHhcC
Confidence            999999999999999987653


No 4  
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=100.00  E-value=1.2e-33  Score=277.91  Aligned_cols=102  Identities=47%  Similarity=0.759  Sum_probs=95.3

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhcCCCC-CCchh
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQHGWTD-GGKIE   79 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~~~~~-~~~i~   79 (380)
                      +|||||+++|+|+||+||||||++||||||+|||||||||||+||+|+++||++|+.|||.+++.||++|++.. ...|+
T Consensus        22 ~CaDCga~~P~W~S~nlGvfiCi~CagvHRsLGvhiS~VKSitLD~wt~~~l~~m~~gGN~~a~~~~e~~~~~~~~~~~k  101 (319)
T COG5347          22 KCADCGAPNPTWASVNLGVFLCIDCAGVHRSLGVHISKVKSLTLDNWTEEELRRMEVGGNSNANRFYEKNLLDQLLLPIK  101 (319)
T ss_pred             ccccCCCCCCceEecccCeEEEeecchhhhccccceeeeeeeecccCCHHHHHHHHHhcchhhhhHhccCCCcccccccc
Confidence            59999999999999999999999999999999999999999999999999999999999999999999998863 36899


Q ss_pred             hhhccHHHHHHHHHHHHHHHHHh
Q 016956           80 AKYTSRAAELYKQILAKEVAKNM  102 (380)
Q Consensus        80 ~KY~~~~a~~Yr~~l~~~v~~~~  102 (380)
                      .||.+.+++.|...+..++...+
T Consensus       102 ~~yd~~v~~~y~~~ky~~~~~~~  124 (319)
T COG5347         102 AKYDSSVAKKYIRKKYELKKFID  124 (319)
T ss_pred             cccCHHHHHHHHHHHHHhhhccc
Confidence            99999999999998887665554


No 5  
>KOG0703 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=99.96  E-value=4e-31  Score=254.72  Aligned_cols=88  Identities=41%  Similarity=0.802  Sum_probs=79.9

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhcCCCC------
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQHGWTD------   74 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~~~~~------   74 (380)
                      +|+|||++.|.|||+++|||||+.|+||||+||||||+||||+||.|+++||..|...||.++|.|||+.....      
T Consensus        27 ~CADC~a~~P~WaSwnlGvFiC~~C~giHR~lg~hiSkVkSv~LD~W~~eqv~~m~~~GN~~an~~~ea~~p~~~~~p~~  106 (287)
T KOG0703|consen   27 VCADCGAKGPRWASWNLGVFICLRCAGIHRSLGVHISKVKSVTLDEWTDEQVDFMISMGNAKANSYYEAKLPDPFRRPGP  106 (287)
T ss_pred             cccccCCCCCCeEEeecCeEEEeecccccccccchhheeeeeeccccCHHHHHHHHHHcchhhhhhccccCCccccCCCh
Confidence            69999999999999999999999999999999999999999999999999999999999999999999872211      


Q ss_pred             ----CCchhhhhccHHHH
Q 016956           75 ----GGKIEAKYTSRAAE   88 (380)
Q Consensus        75 ----~~~i~~KY~~~~a~   88 (380)
                          +.|||.||+.+...
T Consensus       107 d~~~e~FIR~KYE~kkf~  124 (287)
T KOG0703|consen  107 DDLVEQFIRDKYERKKFL  124 (287)
T ss_pred             HHHHHHHHHHHHhhhhhc
Confidence                25899999877543


No 6  
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=99.96  E-value=4e-30  Score=218.57  Aligned_cols=93  Identities=48%  Similarity=0.874  Sum_probs=79.5

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhcCCCCC-----
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQHGWTDG-----   75 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~~~~~~-----   75 (380)
                      +|+|||+++|+|+|++||||||++|+|+||.||+|||+||||+||+|++++|++|+.+||..+|+||++++....     
T Consensus         5 ~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~lg~his~VkSl~md~w~~~~i~~~~~~GN~~~n~~~e~~~~~~~~~~~~   84 (112)
T smart00105        5 KCFDCGAPNPTWASVNLGVFLCIECSGIHRSLGVHISKVRSLTLDTWTEEELRLLQKGGNENANSIWESNLDDFSLKPPD   84 (112)
T ss_pred             cccCCCCCCCCcEEeccceeEhHHhHHHHHhcCCCcCeeeecccCCCCHHHHHHHHHhhhHHHHHHHHhhCCccccCCCC
Confidence            599999999999999999999999999999999999999999999999999999999999999999999865321     


Q ss_pred             CchhhhhccHHHHHHHHH
Q 016956           76 GKIEAKYTSRAAELYKQI   93 (380)
Q Consensus        76 ~~i~~KY~~~~a~~Yr~~   93 (380)
                      .....+|+..+...|+.+
T Consensus        85 ~~~~~~~~~fI~~KY~~k  102 (112)
T smart00105       85 SDDQQKYESFIAAKYEEK  102 (112)
T ss_pred             CchHHHHHHHHHHHHHhh
Confidence            123445555555555443


No 7  
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=99.96  E-value=4.5e-30  Score=219.43  Aligned_cols=70  Identities=54%  Similarity=1.113  Sum_probs=59.2

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhc
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQH   70 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~   70 (380)
                      +|+|||+++|+|+|++||||||+.|+|+||.||+|||+||||+||.|++++|++|+.+||..+|+||+++
T Consensus        15 ~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~lg~~is~VkSi~~d~w~~~ev~~~~~~GN~~~n~~~e~~   84 (116)
T PF01412_consen   15 VCADCGAPNPTWASLNYGIFLCLECAGIHRSLGVHISRVKSITMDNWSPEEVQRMREGGNKRANSIWEAN   84 (116)
T ss_dssp             B-TTT-SBS--EEETTTTEEE-HHHHHHHHHHTTTT--EEETTTS---HHHHHHHHHSHHHHHHHHHTTT
T ss_pred             cCCCCCCCCCCEEEeecChhhhHHHHHHHHHhcccchhccccccCCCCHHHHHHHHHHChHHHHHHHHcC
Confidence            5999999999999999999999999999999999999999999999999999999999999999999998


No 8  
>PLN03131 hypothetical protein; Provisional
Probab=99.89  E-value=8.3e-24  Score=218.95  Aligned_cols=82  Identities=26%  Similarity=0.704  Sum_probs=74.4

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhcCCCC------
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQHGWTD------   74 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~~~~~------   74 (380)
                      +|+||++++|+|+|++||||||+.|+||||.|| |  +||||+||.|+++||+.|+.+||.++|+||+++ |..      
T Consensus        25 ~CADCga~~P~WASiNlGIFICi~CSGIHRsLg-h--RVKSVTLD~WtdeEV~~Mk~gGN~~AN~iyean-wd~~r~~lP  100 (705)
T PLN03131         25 RCINCNSLGPQFVCTNFWTFICMTCSGIHREFT-H--RVKSVSMSKFTSQDVEALQNGGNQRAREIYLKD-WDQQRQRLP  100 (705)
T ss_pred             ccccCCCCCCCeeEeccceEEchhchhhhcccC-c--ccccccCCCCCHHHHHHHHHhccHHHHHHHHhh-cccccCCCC
Confidence            599999999999999999999999999999997 3  899999999999999999999999999999975 211      


Q ss_pred             --------CCchhhhhccHH
Q 016956           75 --------GGKIEAKYTSRA   86 (380)
Q Consensus        75 --------~~~i~~KY~~~~   86 (380)
                              ..||+.||+++.
T Consensus       101 ~~sd~ekrr~FIR~KYVeKR  120 (705)
T PLN03131        101 DNSKVDKIREFIKDIYVDKK  120 (705)
T ss_pred             CCccHHHHHHHHHHHHhhhh
Confidence                    258899998875


No 9  
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=99.89  E-value=7.7e-24  Score=217.71  Aligned_cols=83  Identities=24%  Similarity=0.602  Sum_probs=74.2

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhcCCC------C
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQHGWT------D   74 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~~~~------~   74 (380)
                      +|+|||+++|+|+|++||||||+.|+||||.||   ++||||+||+|+++||++|+.+||.++|+||+++.-.      .
T Consensus        25 ~CADCgs~~P~WASiNlGIFICi~CSGIHRsLG---hRVKSLSLDkWT~EEVe~Mk~gGN~~AN~iyeanw~~~~~~~P~  101 (648)
T PLN03119         25 RCINCNSLGPQYVCTTFWTFVCMACSGIHREFT---HRVKSVSMSKFTSKEVEVLQNGGNQRAREIYLKNWDHQRQRLPE  101 (648)
T ss_pred             ccccCCCCCCCceeeccceEEeccchhhhccCC---ceeeccccCCCCHHHHHHHHHhchHHHHHHHHhhcccccCCCCC
Confidence            599999999999999999999999999999998   4899999999999999999999999999999986211      0


Q ss_pred             -------CCchhhhhccHH
Q 016956           75 -------GGKIEAKYTSRA   86 (380)
Q Consensus        75 -------~~~i~~KY~~~~   86 (380)
                             ..||+.||+++.
T Consensus       102 ~sD~e~lr~FIR~KYVeKR  120 (648)
T PLN03119        102 NSNAERVREFIKNVYVQKK  120 (648)
T ss_pred             CccHHHHHHHHHHHHhhhh
Confidence                   147888888874


No 10 
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms]
Probab=99.82  E-value=1.2e-20  Score=194.02  Aligned_cols=86  Identities=44%  Similarity=0.844  Sum_probs=78.7

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhc--CCC-----
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQH--GWT-----   73 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~--~~~-----   73 (380)
                      .|+||+++||.|||+|+||++|++|+||||+||+|+|+|||+.||.|..+.+..|...||+.||.+|+.-  |-.     
T Consensus       515 ~c~dc~~~n~~wAslnlg~l~cieCsgihr~lgt~lSrvr~LeLDdWPvEl~~Vm~aiGN~~AN~vWE~~~~G~~KPs~~  594 (749)
T KOG0705|consen  515 HCVDCGTPNPKWASLNLGVLMCIECSGIHRNLGTHLSRVRSLELDDWPVELLKVMSAIGNDLANSVWEGSSQGQTKPSPD  594 (749)
T ss_pred             eeeecCCCCcccccccCCeEEEEEchhhhhhhhhhhhhhhccccccCcHHHHHHHHHhhhhHHHHHhhhhccCCcCCCcc
Confidence            5999999999999999999999999999999999999999999999999999999999999999999963  211     


Q ss_pred             -----CCCchhhhhccHH
Q 016956           74 -----DGGKIEAKYTSRA   86 (380)
Q Consensus        74 -----~~~~i~~KY~~~~   86 (380)
                           .+.||+.||+.+.
T Consensus       595 s~REEkErwIr~KYeqkl  612 (749)
T KOG0705|consen  595 SSREEKERWIRAKYEQKL  612 (749)
T ss_pred             ccHHHHHHHHHHHHHHHh
Confidence                 1268999999884


No 11 
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms]
Probab=99.72  E-value=7.5e-19  Score=190.79  Aligned_cols=85  Identities=47%  Similarity=0.800  Sum_probs=78.3

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhcCCCC------
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQHGWTD------   74 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~~~~~------   74 (380)
                      +|+|||++.|+|+|+|+||.+||+|+|+||+||||||+|||++||.|..+.+.+|+.+||..+|.+|+.+.+..      
T Consensus       428 ~c~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD~~~~~l~~l~~~lgn~~~N~i~e~~l~~~~~~~~~  507 (785)
T KOG0521|consen  428 QCCDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLDVWEPELLLLFKNLGNKYVNEIYEALLPSYDSSKPT  507 (785)
T ss_pred             hhhhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhhccCcHHHHHHHHhCcchhhhhhhcccccccccCCC
Confidence            59999999999999999999999999999999999999999999999999999999999999999999875422      


Q ss_pred             --------CCchhhhhccH
Q 016956           75 --------GGKIEAKYTSR   85 (380)
Q Consensus        75 --------~~~i~~KY~~~   85 (380)
                              ..+|++||..+
T Consensus       508 ~~~~~~~r~~~i~~kyve~  526 (785)
T KOG0521|consen  508 ASSSRQAREAWIKAKYVER  526 (785)
T ss_pred             CccchhhhhHhhhccccee
Confidence                    14688888876


No 12 
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms]
Probab=99.66  E-value=2.2e-17  Score=167.80  Aligned_cols=86  Identities=41%  Similarity=0.696  Sum_probs=78.6

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhhcCCCC------
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQHGWTD------   74 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~~~~~~------   74 (380)
                      +|.|||++.|.||||+-|+|||.+|..+||+||.|||.||++....|.+..|++.....|..+|.+|+.+.++.      
T Consensus        10 vC~DC~~~dp~WASvnrGt~lC~eCcsvHrsLGrhIS~vrhLR~s~W~pt~l~~V~tLn~~gaNsIWEh~Lld~st~~sg   89 (669)
T KOG0818|consen   10 VCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLRHTPWPPTLLQMVETLNNNGANSIWEHSLLDPATIMSG   89 (669)
T ss_pred             hhcccCCCCCcceeecCceEehHhhhHHHhhhcchHHHHHHhccCCCCHHHHHHHHHHHhcCcchhhhhhccCchhhhcc
Confidence            69999999999999999999999999999999999999999999999999999999999999999999873221      


Q ss_pred             --------------CCchhhhhccHH
Q 016956           75 --------------GGKIEAKYTSRA   86 (380)
Q Consensus        75 --------------~~~i~~KY~~~~   86 (380)
                                    ..||++||...+
T Consensus        90 ~rk~~pqD~~Hp~K~eFIkaKy~~Lt  115 (669)
T KOG0818|consen   90 RRKANPQDKVHPNKAEFIRAKYQMLA  115 (669)
T ss_pred             cCCCCCcCCCCccHHHHHHHHHHhee
Confidence                          257999998764


No 13 
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton]
Probab=99.47  E-value=9.9e-15  Score=155.71  Aligned_cols=86  Identities=35%  Similarity=0.644  Sum_probs=78.3

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcCCCccccccccCCCC--CCHHHHHHHhcCChHHHHHHHhhcCCCC----
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDS--WSAEQLKMMVYGGNNRAQVFFKQHGWTD----   74 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~--W~~~~l~~m~~gGN~~~~~~~~~~~~~~----   74 (380)
                      .|+|||++.|.|||+|++|.||-.|+|-||+||..+|+|+|+.||.  |+.+-++++-+.||..+|.||..+....    
T Consensus       300 ~cadC~ssrPdwasiNL~vvIck~caGqhrslgs~dSkvrslkmd~svwsneliElfivlgn~~an~Fwa~nl~~~e~lh  379 (1186)
T KOG1117|consen  300 ECADCGSSRPDWASINLCVVICKPCAGQHRSLGSGDSKVRSLKMDPSVWSNELIELFIVLGNPRANRFWAGNLPPNEHLH  379 (1186)
T ss_pred             cccccCCCCCcccccccceEEcccCCCccccCCCccccccccccCcccccchhhhhheeecCcccccccccCCCCccccC
Confidence            4999999999999999999999999999999999999999999996  9999999999999999999998763221    


Q ss_pred             --------CCchhhhhccHH
Q 016956           75 --------GGKIEAKYTSRA   86 (380)
Q Consensus        75 --------~~~i~~KY~~~~   86 (380)
                              ..+|++||++-.
T Consensus       380 ~dssp~~r~~fi~~Kykeg~  399 (1186)
T KOG1117|consen  380 PDSSPSTRRQFIKEKYKEGK  399 (1186)
T ss_pred             CCCCcchhhhHHHHHhhccc
Confidence                    268999998864


No 14 
>KOG0702 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=98.44  E-value=9.9e-08  Score=98.19  Aligned_cols=68  Identities=22%  Similarity=0.483  Sum_probs=63.8

Q ss_pred             CCCCCCCCCC-CeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHHhh
Q 016956            1 MCFDCNAKNP-TWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFFKQ   69 (380)
Q Consensus         1 ~C~DCga~~P-~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~~~   69 (380)
                      +|++|....+ +|.+++-|-|+|+.|+|..|.| .--++||||.|-.++..++..++.+||+.++++|.+
T Consensus        27 rC~nCnsl~~~t~~~~~~g~fv~~~~sg~ls~l-~~ahRvksiSmttft~qevs~lQshgNq~~k~i~fk   95 (524)
T KOG0702|consen   27 RCINCNSLVAATYVVYTVGSFVCTMCSGLLSGL-NPAHRVKSISMTTFTDQEVSFLQSHGNQVCKEIWFK   95 (524)
T ss_pred             ceeeccccccceEEEeeccceeeeccchhhccC-CCccccceeeeeeccccchHHHhhcchhhhhhhhhc
Confidence            5999999888 9999999999999999999998 456799999999999999999999999999999975


No 15 
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms]
Probab=92.92  E-value=0.023  Score=63.28  Aligned_cols=65  Identities=18%  Similarity=0.208  Sum_probs=52.0

Q ss_pred             CCCCCCC-CCCCeeEeccceeecccchhhhhcCCCccccccccCCCCCCHHHHHHHhcCChHHHHHHH
Q 016956            1 MCFDCNA-KNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSAEQLKMMVYGGNNRAQVFF   67 (380)
Q Consensus         1 ~C~DCga-~~P~WaSv~~GiflC~~Csg~HR~LG~hiS~VkS~~lD~W~~~~l~~m~~gGN~~~~~~~   67 (380)
                      .|.+|++ ..-.|+++++.+-+|++|+++|+.++.|++.++++.|++-.+  +.....-||...+.-+
T Consensus       632 ~~~~~~~~~~~~~~~~n~~~~~~~~~s~lh~a~~~~~~~~~e~ll~~ga~--vn~~d~~g~~plh~~~  697 (785)
T KOG0521|consen  632 ECLPRIATALAHGCCENWPVVLCIGCSLLHVAVGTGDSGAVELLLQNGAD--VNALDSKGRTPLHHAT  697 (785)
T ss_pred             cchhhhhhhhcchhhhccchhhhcccchhhhhhccchHHHHHHHHhcCCc--chhhhccCCCcchhhh
Confidence            3788886 679999999999999999999999999999999999888766  5444444444444433


No 16 
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=87.78  E-value=0.89  Score=46.42  Aligned_cols=20  Identities=50%  Similarity=0.846  Sum_probs=17.7

Q ss_pred             hhccCCcccccccccCCCCC
Q 016956          308 QKFSGSASISSADLFGHDSD  327 (380)
Q Consensus       308 ~~F~gatsISS~~yFg~~~~  327 (380)
                      ++|.|+.+|||++|||+...
T Consensus       300 kKF~naKsisS~qfFg~~~~  319 (395)
T PLN03114        300 KKFTNAKSISSAQYFGNDNN  319 (395)
T ss_pred             HHhcccccccHHhhcccccc
Confidence            56999999999999998753


No 17 
>KOG0706 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=86.86  E-value=1.6  Score=45.59  Aligned_cols=75  Identities=24%  Similarity=0.295  Sum_probs=50.7

Q ss_pred             hhhhHHHHHHhccCCcCccccccCCCCCccchhHHHHhhhccCCcccccccccCCCCCCcccchhhHHHHHHhhhchHHH
Q 016956          270 IQETDEARKKFSNAKSISSSQFFGDQNNSIDMDTQVSLQKFSGSASISSADLFGHDSDNASLDLAASDLINRLSFQAQQD  349 (380)
Q Consensus       270 ~~~t~~a~~KFgnaKaISSd~yFGr~~~~a~~ea~~rL~~F~gatsISS~~yFg~~~~~~~~~~sA~dl~~~~~~~a~~D  349 (380)
                      .-++....+||.++-+|||-.|||.+++                 .+...++.++..    +.... ||+. |.    .=
T Consensus       378 d~Ea~~~L~~f~gstaISSsd~fG~~~~-----------------~~~~g~~~~~~~----~~a~~-di~~-~k----~~  430 (454)
T KOG0706|consen  378 DLEARARLQKFSGSTAISSSDLFGEGDD-----------------DHTAGSLALRDS----FRAAQ-DIAS-FK----NS  430 (454)
T ss_pred             hhHHHHHHHhccCccccchHhhcCCCCC-----------------CCCccchhhccc----ccccc-cHHH-HH----HH
Confidence            3466777899999999999999999984                 334444444431    22222 5554 32    23


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q 016956          350 ISSLKNIAGETGKKLSSLASSL  371 (380)
Q Consensus       350 l~~lk~~v~~~A~KLs~~a~~~  371 (380)
                      +.+++.-+..+|.||.+..+..
T Consensus       431 ~~~~a~kls~~a~~v~~~~qd~  452 (454)
T KOG0706|consen  431 ARSVAGKLSVLASKVGSSLQDR  452 (454)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            3458999999999988876654


No 18 
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=78.99  E-value=1.3  Score=41.90  Aligned_cols=28  Identities=25%  Similarity=0.496  Sum_probs=23.7

Q ss_pred             CCCCCCCCCC-CeeEeccceeecccchhh
Q 016956            1 MCFDCNAKNP-TWASVTYGIFLCIDCSAV   28 (380)
Q Consensus         1 ~C~DCga~~P-~WaSv~~GiflC~~Csg~   28 (380)
                      .|.-||.+.. .|.++..|.++|..|...
T Consensus       151 ~C~~Cg~~~~~~~f~~~~gg~~c~~c~~~  179 (247)
T PRK00085        151 HCAVCGAPGDHRYFSPKEGGAVCSECGDP  179 (247)
T ss_pred             hHhcCCCCCCceEEecccCCcccccccCc
Confidence            4999998755 788999999999999733


No 19 
>TIGR00613 reco DNA repair protein RecO. All proteins in this family for which functions are known are DNA binding proteins that are involved in the initiation of recombination or recombinational repair.
Probab=66.09  E-value=3.6  Score=38.77  Aligned_cols=28  Identities=36%  Similarity=0.721  Sum_probs=23.3

Q ss_pred             CCCCCCCCCC-CeeEeccceeecccchhh
Q 016956            1 MCFDCNAKNP-TWASVTYGIFLCIDCSAV   28 (380)
Q Consensus         1 ~C~DCga~~P-~WaSv~~GiflC~~Csg~   28 (380)
                      .|..||..++ .|.++..|.++|.+|...
T Consensus       149 ~C~~cg~~~~~~~fs~~~gg~~C~~c~~~  177 (241)
T TIGR00613       149 KCAVCGSKEDLIYFSMTYGGALCRQCGEK  177 (241)
T ss_pred             ccCCCCCcCCCceEchhcCeEEChhhCcc
Confidence            4999998654 688999999999999654


No 20 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=62.36  E-value=5.7  Score=27.13  Aligned_cols=32  Identities=28%  Similarity=0.731  Sum_probs=23.6

Q ss_pred             CCCCCCC-CCCeeEecccee-ecccchhhhhcCC
Q 016956            2 CFDCNAK-NPTWASVTYGIF-LCIDCSAVHRSLG   33 (380)
Q Consensus         2 C~DCga~-~P~WaSv~~Gif-lC~~Csg~HR~LG   33 (380)
                      |..|+.. -|.|-..+.|-. ||-.|--.+|..|
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk~~   34 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKKYG   34 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHHHS
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHHhC
Confidence            8899974 699999999988 9999977666544


No 21 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=56.41  E-value=6.2  Score=28.71  Aligned_cols=26  Identities=31%  Similarity=0.821  Sum_probs=20.6

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchh
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSA   27 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg   27 (380)
                      +|+=|+...+. .=+=+|.|||.+|-.
T Consensus         1 ~CiiC~~~~~~-GI~I~~~fIC~~CE~   26 (46)
T PF10764_consen    1 KCIICGKEKEE-GIHIYGKFICSDCEK   26 (46)
T ss_pred             CeEeCCCcCCC-CEEEECeEehHHHHH
Confidence            58889988877 445589999999954


No 22 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=55.96  E-value=6.6  Score=26.97  Aligned_cols=31  Identities=16%  Similarity=0.351  Sum_probs=26.1

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhh-hhc
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAV-HRS   31 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~-HR~   31 (380)
                      .|..|+.....|-+.+=.++||..|... |+.
T Consensus         5 ~C~~H~~~~~~~~C~~C~~~~C~~C~~~~H~~   36 (42)
T PF00643_consen    5 KCPEHPEEPLSLFCEDCNEPLCSECTVSGHKG   36 (42)
T ss_dssp             B-SSTTTSBEEEEETTTTEEEEHHHHHTSTTT
T ss_pred             cCccCCccceEEEecCCCCccCccCCCCCCCC
Confidence            4777888778899999999999999987 886


No 23 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=51.05  E-value=9.3  Score=26.84  Aligned_cols=25  Identities=24%  Similarity=0.635  Sum_probs=20.0

Q ss_pred             CCCCCCCCCCCeeEeccceeecccch
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCS   26 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Cs   26 (380)
                      +|-.||+.. .-..-..|-++|..|-
T Consensus         2 ~Cp~Cg~~~-~~~D~~~g~~vC~~CG   26 (43)
T PF08271_consen    2 KCPNCGSKE-IVFDPERGELVCPNCG   26 (43)
T ss_dssp             SBTTTSSSE-EEEETTTTEEEETTT-
T ss_pred             CCcCCcCCc-eEEcCCCCeEECCCCC
Confidence            588999977 5556778999999993


No 24 
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=48.15  E-value=15  Score=27.13  Aligned_cols=35  Identities=26%  Similarity=0.591  Sum_probs=28.4

Q ss_pred             CCCCCCC-CCCCeeEeccce-eecccchhhhhcCCCc
Q 016956            1 MCFDCNA-KNPTWASVTYGI-FLCIDCSAVHRSLGVH   35 (380)
Q Consensus         1 ~C~DCga-~~P~WaSv~~Gi-flC~~Csg~HR~LG~h   35 (380)
                      .|..|+. .-|.|=..+.|- +||-.|--..+..|..
T Consensus         5 ~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~~   41 (52)
T smart00401        5 SCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGGL   41 (52)
T ss_pred             CcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCCC
Confidence            5999997 458999999996 9999997777765543


No 25 
>COG1381 RecO Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=44.19  E-value=11  Score=36.45  Aligned_cols=26  Identities=35%  Similarity=0.783  Sum_probs=23.3

Q ss_pred             CCCCCCCCC-CCeeEeccceeecccch
Q 016956            1 MCFDCNAKN-PTWASVTYGIFLCIDCS   26 (380)
Q Consensus         1 ~C~DCga~~-P~WaSv~~GiflC~~Cs   26 (380)
                      .|+.||.+- |...|+-.|-++|..|.
T Consensus       156 ~Ca~cg~~~~~~~~s~~~~~~~C~~~~  182 (251)
T COG1381         156 SCARCGTPVDPVYFSPKSGGFLCSKCA  182 (251)
T ss_pred             HHhCcCCcCCCcceeeccCcccchhcc
Confidence            499999975 57999999999999998


No 26 
>PRK12495 hypothetical protein; Provisional
Probab=41.82  E-value=13  Score=35.67  Aligned_cols=23  Identities=22%  Similarity=0.475  Sum_probs=19.0

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchh
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSA   27 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg   27 (380)
                      .|-+||.+-|.    --|+.+|..|..
T Consensus        44 hC~~CG~PIpa----~pG~~~Cp~CQ~   66 (226)
T PRK12495         44 HCDECGDPIFR----HDGQEFCPTCQQ   66 (226)
T ss_pred             hcccccCcccC----CCCeeECCCCCC
Confidence            59999999993    269999999963


No 27 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=39.71  E-value=22  Score=29.49  Aligned_cols=25  Identities=32%  Similarity=0.711  Sum_probs=20.5

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchh
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSA   27 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg   27 (380)
                      .|-.|+.+  +--=+..||+.|..|-.
T Consensus        37 ~Cp~C~~~--~VkR~a~GIW~C~kCg~   61 (89)
T COG1997          37 VCPFCGRT--TVKRIATGIWKCRKCGA   61 (89)
T ss_pred             cCCCCCCc--ceeeeccCeEEcCCCCC
Confidence            48899987  56677899999999943


No 28 
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=38.57  E-value=18  Score=26.98  Aligned_cols=34  Identities=29%  Similarity=0.691  Sum_probs=27.4

Q ss_pred             CCCCCCCC-CCCeeEec-cceeecccchhhhhcCCC
Q 016956            1 MCFDCNAK-NPTWASVT-YGIFLCIDCSAVHRSLGV   34 (380)
Q Consensus         1 ~C~DCga~-~P~WaSv~-~GiflC~~Csg~HR~LG~   34 (380)
                      +|..|+.. -|.|-..+ -+..||-.|--..+..|.
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~   36 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGV   36 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCC
Confidence            69999974 58899876 788999999776666663


No 29 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=37.62  E-value=13  Score=26.64  Aligned_cols=27  Identities=26%  Similarity=0.598  Sum_probs=19.1

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcC
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSL   32 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~L   32 (380)
                      +|.+||......   .....-|..|  -||.|
T Consensus         4 ~C~~Cg~~~~~~---~~~~irC~~C--G~rIl   30 (44)
T smart00659        4 ICGECGRENEIK---SKDVVRCREC--GYRIL   30 (44)
T ss_pred             ECCCCCCEeecC---CCCceECCCC--CceEE
Confidence            599999865543   5677899998  34543


No 30 
>PRK11019 hypothetical protein; Provisional
Probab=36.11  E-value=6  Score=32.70  Aligned_cols=35  Identities=20%  Similarity=0.542  Sum_probs=24.7

Q ss_pred             CCCCCCCCCC--CeeEeccceeecccchhhhhcCCCcc
Q 016956            1 MCFDCNAKNP--TWASVTYGIFLCIDCSAVHRSLGVHI   36 (380)
Q Consensus         1 ~C~DCga~~P--~WaSv~~GiflC~~Csg~HR~LG~hi   36 (380)
                      +|.|||.+=|  .|.-++ ++-+|++|...+-..+.|.
T Consensus        38 ~C~~CG~~Ip~~Rl~A~P-~a~~Cv~Cq~~~E~~~k~~   74 (88)
T PRK11019         38 ECEECGEPIPEARRKAIP-GVRLCVACQQEKDLQQAAF   74 (88)
T ss_pred             eeCcCCCcCcHHHHhhcC-CccccHHHHHHHHHHHhHh
Confidence            5999998655  355454 6779999998776555443


No 31 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=32.66  E-value=14  Score=25.38  Aligned_cols=26  Identities=15%  Similarity=0.544  Sum_probs=15.6

Q ss_pred             CCCCCCCC-CCCeeEeccceeecccch
Q 016956            1 MCFDCNAK-NPTWASVTYGIFLCIDCS   26 (380)
Q Consensus         1 ~C~DCga~-~P~WaSv~~GiflC~~Cs   26 (380)
                      .|.+|+.+ .-+|..-+|+.-+|..|.
T Consensus         5 ~C~eC~~~f~dSyL~~~F~~~VCD~CR   31 (34)
T PF01286_consen    5 KCDECGKPFMDSYLLNNFDLPVCDKCR   31 (34)
T ss_dssp             E-TTT--EES-SSCCCCTS-S--TTT-
T ss_pred             hHhHhCCHHHHHHHHHhCCcccccccc
Confidence            49999974 578999999999999994


No 32 
>PHA00080 DksA-like zinc finger domain containing protein
Probab=32.64  E-value=9.6  Score=30.19  Aligned_cols=29  Identities=21%  Similarity=0.572  Sum_probs=19.5

Q ss_pred             CCCCCCCCC--CCeeEeccceeecccchhhhh
Q 016956            1 MCFDCNAKN--PTWASVTYGIFLCIDCSAVHR   30 (380)
Q Consensus         1 ~C~DCga~~--P~WaSv~~GiflC~~Csg~HR   30 (380)
                      +|.+||.+=  ..|.-++ ++..|++|...+-
T Consensus        33 ~C~~Cg~~Ip~~Rl~a~P-~~~~Cv~Cq~~~E   63 (72)
T PHA00080         33 HCEECGDPIPEARREAVP-GCRTCVSCQEILE   63 (72)
T ss_pred             EecCCCCcCcHHHHHhCC-CccCcHHHHHHHH
Confidence            499999854  3444455 4556999987653


No 33 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=31.75  E-value=33  Score=23.59  Aligned_cols=21  Identities=29%  Similarity=0.925  Sum_probs=19.0

Q ss_pred             CCCCCCCCCCeeEeccceeecccc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDC   25 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~C   25 (380)
                      |..|++.   |....=|-+.|..|
T Consensus        11 C~~C~~~---~~~~~dG~~yC~~c   31 (36)
T PF11781_consen   11 CPVCGSR---WFYSDDGFYYCDRC   31 (36)
T ss_pred             CCCCCCe---EeEccCCEEEhhhC
Confidence            8888887   99999999999998


No 34 
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family.  Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription 
Probab=30.09  E-value=26  Score=29.31  Aligned_cols=27  Identities=26%  Similarity=0.716  Sum_probs=22.0

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.   ....||++.|..|.++.|-
T Consensus         7 C~VCg~~a---~g~hyGv~sC~aCk~FFRR   33 (97)
T cd07170           7 CLVCGDIA---SGYHYGVASCEACKAFFKR   33 (97)
T ss_pred             CeecCCcC---cceEECceeehhhhHHHHH
Confidence            77788654   4568999999999998874


No 35 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=30.07  E-value=13  Score=25.01  Aligned_cols=22  Identities=23%  Similarity=0.587  Sum_probs=13.8

Q ss_pred             CCCCCCCCCCCeeEeccceeecccc
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDC   25 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~C   25 (380)
                      +|.+||+.+.  .. .....-|..|
T Consensus         2 ~C~~Cg~~~~--~~-~~~~irC~~C   23 (32)
T PF03604_consen    2 ICGECGAEVE--LK-PGDPIRCPEC   23 (32)
T ss_dssp             BESSSSSSE---BS-TSSTSSBSSS
T ss_pred             CCCcCCCeeE--cC-CCCcEECCcC
Confidence            5899998765  11 2334578888


No 36 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=28.56  E-value=36  Score=27.70  Aligned_cols=28  Identities=18%  Similarity=0.613  Sum_probs=22.5

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      +|.-||.+.-   ...||++.|..|.++.|-
T Consensus         1 ~C~VCg~~~~---g~hygv~sC~aC~~FFRR   28 (87)
T cd07162           1 ICRVCGDRAT---GYHFNAMTCEGCKGFFRR   28 (87)
T ss_pred             CCcccCCcCc---ceEECcceehhhHHHHHh
Confidence            4888887544   358999999999998874


No 37 
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=28.10  E-value=32  Score=28.62  Aligned_cols=27  Identities=30%  Similarity=0.828  Sum_probs=22.1

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.   ....||++.|..|.++.|-
T Consensus         8 C~VCg~~~---~g~hyGv~sC~aC~~FFRR   34 (95)
T cd06968           8 CKICGDKS---SGIHYGVITCEGCKGFFRR   34 (95)
T ss_pred             CcccCCcC---cceEECceeehhhHHhhHH
Confidence            77888754   4568999999999998874


No 38 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=27.81  E-value=35  Score=25.87  Aligned_cols=24  Identities=25%  Similarity=0.695  Sum_probs=20.1

Q ss_pred             CCCCCCCCCCCeeEeccceeecccch
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCS   26 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Cs   26 (380)
                      .|..||.....  ..+.-+|.|..|-
T Consensus        30 ~C~~CG~~~~~--~~~~r~~~C~~Cg   53 (69)
T PF07282_consen   30 TCPRCGHRNKK--RRSGRVFTCPNCG   53 (69)
T ss_pred             CccCccccccc--ccccceEEcCCCC
Confidence            48899988877  7788899999983


No 39 
>PF14376 Haem_bd:  Haem-binding domain
Probab=27.14  E-value=28  Score=30.63  Aligned_cols=13  Identities=31%  Similarity=1.091  Sum_probs=10.5

Q ss_pred             CCCCCCCCCCCee
Q 016956            1 MCFDCNAKNPTWA   13 (380)
Q Consensus         1 ~C~DCga~~P~Wa   13 (380)
                      -|.||++.+..|-
T Consensus        43 ~CydCHSn~T~~P   55 (137)
T PF14376_consen   43 SCYDCHSNNTRYP   55 (137)
T ss_pred             cccccCCCCCCCc
Confidence            3999999887665


No 40 
>COG2174 RPL34A Ribosomal protein L34E [Translation, ribosomal structure and biogenesis]
Probab=26.38  E-value=31  Score=28.77  Aligned_cols=14  Identities=36%  Similarity=0.954  Sum_probs=11.4

Q ss_pred             Eeccceeecccchh
Q 016956           14 SVTYGIFLCIDCSA   27 (380)
Q Consensus        14 Sv~~GiflC~~Csg   27 (380)
                      +=+||-.+|..|..
T Consensus        66 ~RpYGG~lc~~c~~   79 (93)
T COG2174          66 ERPYGGYLCANCVR   79 (93)
T ss_pred             CCCcCceecHHHHH
Confidence            45699999999954


No 41 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=26.38  E-value=42  Score=33.40  Aligned_cols=28  Identities=25%  Similarity=0.628  Sum_probs=20.1

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhh
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVH   29 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~H   29 (380)
                      .|.+||..+.. ....-|-.+|.+|--|.
T Consensus        13 ~Cp~Cg~~~iv-~d~~~Ge~vC~~CG~Vl   40 (310)
T PRK00423         13 VCPECGSDKLI-YDYERGEIVCADCGLVI   40 (310)
T ss_pred             cCcCCCCCCee-EECCCCeEeecccCCcc
Confidence            59999974332 23567999999996543


No 42 
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=26.28  E-value=27  Score=28.39  Aligned_cols=27  Identities=22%  Similarity=0.592  Sum_probs=22.0

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.   ....||++.|..|.++.|-
T Consensus         3 C~VCg~~a---~g~hyGv~sC~aCk~FFRR   29 (86)
T cd07157           3 CQVCGEPA---AGFHHGAYVCEACKKFFMR   29 (86)
T ss_pred             CcccCCcC---cccEECcceeeEeeeEEec
Confidence            77788654   4569999999999998875


No 43 
>PRK13715 conjugal transfer protein TraR; Provisional
Probab=25.24  E-value=14  Score=29.35  Aligned_cols=31  Identities=26%  Similarity=0.674  Sum_probs=18.6

Q ss_pred             CCCCCCCCCCCee-Eeccceeecccchhhhhc
Q 016956            1 MCFDCNAKNPTWA-SVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         1 ~C~DCga~~P~Wa-Sv~~GiflC~~Csg~HR~   31 (380)
                      .|.|||.+=|.=- -.-=|+..|+.|...+-.
T Consensus        36 ~C~~Cg~~Ip~~Rl~a~p~~~~Cv~Cq~~~E~   67 (73)
T PRK13715         36 LCEACGNPIPEARRKIFPGVTLCVECQAYQER   67 (73)
T ss_pred             cHhhcCCcCCHHHHhcCCCcCCCHHHHHHHHH
Confidence            4888887644221 111267789998775543


No 44 
>TIGR02419 C4_traR_proteo phage/conjugal plasmid C-4 type zinc finger protein, TraR family. Members of this family are putative C4-type zinc finger proteins found almost exclusively in prophage regions, actual phage, or conjugal transfer regions of the Proteobactia. This small protein (about 70 amino acids) appears homologous to but is smaller than DksA (DnaK suppressor protein), found to be critical for regulating transcription of ribosomal RNA.
Probab=24.70  E-value=16  Score=28.06  Aligned_cols=28  Identities=25%  Similarity=0.725  Sum_probs=16.9

Q ss_pred             CCCCCCCCCC--CeeEeccceeecccchhhh
Q 016956            1 MCFDCNAKNP--TWASVTYGIFLCIDCSAVH   29 (380)
Q Consensus         1 ~C~DCga~~P--~WaSv~~GiflC~~Csg~H   29 (380)
                      .|.|||.+=|  .|.-++ |+..|++|...|
T Consensus        33 ~C~~Cg~~Ip~~Rl~a~p-~~~~Cv~Cq~~~   62 (63)
T TIGR02419        33 ECEDCGEPIPEARREALP-GVTRCVSCQEIL   62 (63)
T ss_pred             eeccCCCcChHHHHhhcC-CcCCcHHHHhhc
Confidence            4888887544  222222 667788886543


No 45 
>PF13119 DUF3973:  Domain of unknown function (DUF3973)
Probab=24.61  E-value=32  Score=24.43  Aligned_cols=13  Identities=38%  Similarity=1.134  Sum_probs=10.8

Q ss_pred             eecccchhhhhcC
Q 016956           20 FLCIDCSAVHRSL   32 (380)
Q Consensus        20 flC~~Csg~HR~L   32 (380)
                      |-|+.||.+|-.-
T Consensus         2 yYCi~Cs~~h~e~   14 (41)
T PF13119_consen    2 YYCINCSEIHHEK   14 (41)
T ss_pred             EEEEEhHHhHHhh
Confidence            6799999999753


No 46 
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=24.30  E-value=31  Score=27.93  Aligned_cols=27  Identities=30%  Similarity=0.776  Sum_probs=21.8

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.   ....||++.|..|.+++|-
T Consensus         2 C~VCg~~~---~g~hyGv~sC~aCk~FFRR   28 (84)
T cd06965           2 CRVCGDKA---SGFHYGVHACEGCKGFFRR   28 (84)
T ss_pred             CcccCccC---cceEEChhhhhhhhhheee
Confidence            77788644   3467999999999999875


No 47 
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=24.23  E-value=39  Score=27.08  Aligned_cols=27  Identities=30%  Similarity=0.715  Sum_probs=21.6

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.-   ...||++.|..|.++.|-
T Consensus         1 C~VCg~~~~---g~hyG~~sC~aC~~FFRR   27 (81)
T cd07165           1 CKVCGDKAS---GYHYGVTSCEGCKGFFRR   27 (81)
T ss_pred             CCccCccCc---ceEECchhhhhHHHHHHh
Confidence            666876443   569999999999998885


No 48 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=23.67  E-value=54  Score=23.16  Aligned_cols=22  Identities=27%  Similarity=0.637  Sum_probs=15.5

Q ss_pred             CCCCCCCCCCCeeEeccceeec
Q 016956            1 MCFDCNAKNPTWASVTYGIFLC   22 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC   22 (380)
                      .|.+|+..+.-|+++.-+-..|
T Consensus         1 ~C~~C~~~~~l~~CL~C~~~~c   22 (50)
T smart00290        1 RCSVCGTIENLWLCLTCGQVGC   22 (50)
T ss_pred             CcccCCCcCCeEEecCCCCccc
Confidence            5999998777776666555555


No 49 
>COG2158 Uncharacterized protein containing a Zn-finger-like domain [General function prediction only]
Probab=23.26  E-value=52  Score=28.30  Aligned_cols=32  Identities=31%  Similarity=0.725  Sum_probs=26.0

Q ss_pred             CCCCCCCCCCeeEeccc--eeecccchhhhhcCCCc
Q 016956            2 CFDCNAKNPTWASVTYG--IFLCIDCSAVHRSLGVH   35 (380)
Q Consensus         2 C~DCga~~P~WaSv~~G--iflC~~Csg~HR~LG~h   35 (380)
                      |.+|+--  .|.+-.-|  |.-|.+|--+||.-++.
T Consensus        45 c~~~~~g--ewi~~~~G~~VwSC~dC~~iH~ke~~~   78 (112)
T COG2158          45 CENEELG--EWISDSNGRKVWSCSDCHWIHRKEGAE   78 (112)
T ss_pred             ccccccC--ceeEcCCCCEEeeccccceecccchHH
Confidence            5566554  99999999  99999999999976543


No 50 
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=23.05  E-value=41  Score=28.33  Aligned_cols=27  Identities=26%  Similarity=0.720  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.   ....||+..|..|.++.|-
T Consensus        21 C~VCg~~a---~g~hyGv~sC~aCk~FFRR   47 (101)
T cd07160          21 CSVCGDKA---SGFHYNVLSCEGCKGFFRR   47 (101)
T ss_pred             CeecCCcC---cceEECcceehhhhhhhhh
Confidence            77788643   3578999999999998874


No 51 
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=22.99  E-value=42  Score=27.78  Aligned_cols=28  Identities=25%  Similarity=0.610  Sum_probs=22.0

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      .|.-||.+.   ....||++.|..|.++.|-
T Consensus         2 ~C~VCg~~a---~g~hyGv~sC~aC~~FFRR   29 (94)
T cd06966           2 ICGVCGDKA---LGYNFNAITCESCKAFFRR   29 (94)
T ss_pred             CCeeCCCcC---cceEECcceeeeehheehh
Confidence            377788643   3568999999999998875


No 52 
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER  has  a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserv
Probab=22.68  E-value=43  Score=27.01  Aligned_cols=27  Identities=26%  Similarity=0.747  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.   ....||++.|..|.++.|-
T Consensus         6 C~VCg~~~---~g~hyGv~sC~aC~~FFRR   32 (82)
T cd07171           6 CAVCSDYA---SGYHYGVWSCEGCKAFFKR   32 (82)
T ss_pred             CeecCCcC---cceEECceeehhhHHhHHH
Confidence            67787643   4579999999999998874


No 53 
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=22.65  E-value=44  Score=27.39  Aligned_cols=27  Identities=30%  Similarity=0.790  Sum_probs=21.9

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.   ....||++.|..|.++.|-
T Consensus         9 C~VCg~~~---~g~hyGv~sC~aCk~FFRR   35 (90)
T cd07168           9 CSICEDKA---TGLHYGIITCEGCKGFFKR   35 (90)
T ss_pred             CcccCCcC---cceEECceehhhhhHhhhh
Confidence            77788644   3579999999999998874


No 54 
>PTZ00074 60S ribosomal protein L34; Provisional
Probab=22.28  E-value=41  Score=30.02  Aligned_cols=25  Identities=40%  Similarity=0.753  Sum_probs=17.2

Q ss_pred             CCCCCCCCC-------C----------CeeEeccceeecccc
Q 016956            1 MCFDCNAKN-------P----------TWASVTYGIFLCIDC   25 (380)
Q Consensus         1 ~C~DCga~~-------P----------~WaSv~~GiflC~~C   25 (380)
                      .|.|||.+-       |          .-++=.||-.||..|
T Consensus        43 kC~~cg~~L~GI~~~Rp~e~~rlsK~~KtvsRaYGG~lC~~C   84 (135)
T PTZ00074         43 KCGDCGKVLAGIKALRPTEYKQLSRRERTVSRAYGGVLCHKC   84 (135)
T ss_pred             CCCCCCCccCCccCCchHHHHHccccCCCccCCCccchhHHH
Confidence            499999652       1          123556888888888


No 55 
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=22.15  E-value=52  Score=25.71  Aligned_cols=27  Identities=19%  Similarity=0.581  Sum_probs=20.9

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.-   ...||++.|..|.++.|-
T Consensus         1 C~VC~~~~~---g~hygv~sC~aC~~FFRR   27 (72)
T cd07156           1 CGVCGDRAT---GYHFNAMTCEGCKGFFRR   27 (72)
T ss_pred             CCccCccCc---ccEECcceehhhhhhhch
Confidence            566776444   358999999999998874


No 56 
>PF04770 ZF-HD_dimer:  ZF-HD protein dimerisation region;  InterPro: IPR006456 The homeodomain (HD) is a 60-amino acid DNA-binding domain found in many transcription factors. HD-containing proteins are found in diverse organisms such as humans, Drosophila, nematode worms, and plants, where they play important roles in development. Zinc-finger-homeodomain (ZF- HD) subfamily proteins have only been identified in plants, and likely play plant specific roles. ZF-HD proteins are expressed predominantly or exclusively in floral tissue, indicating a likely regulatory role during floral development []. The ZF-HD class of homeodomain proteins may also be involved in the photosynthesis-related mesophyll-specific gene expression of phosphoenolpyruvate carboxylase in C4 species [] and in pathogen signaling and plant defense mechanisms [].  These proteins share three domains of high sequence similarity: the homeodomain (II) located at the carboxy-terminus, and two other segments (Ia and Ib) located in the amino-terminal part. These N-terminal domains contain five conserved cysteine residues and at least three conserved histidine residues whose spacing ressembles zinc-binding domains involved in dimerization of transcription factors. Although the two domains contain at least eight potential zinc-binding amino-acids, the unique spacing of the conserved cysteine and histidine residues within domain Ib suggests that both domains form one rather than two zinc finger structures. The two conserved motifs Ia and Ib constitute a dimerization domain which is sufficient for the formation of homo- and heterodimers [].  This entry represents the N-terminal Cysteine/Histidine-rich dimerization domain. The companion ZF-HD homeobox domain is described in IPR006455 from INTERPRO. 
Probab=22.13  E-value=38  Score=26.14  Aligned_cols=29  Identities=28%  Similarity=0.540  Sum_probs=23.1

Q ss_pred             CC-CCCCCCC-eeEeccceeecccchhhhhcC
Q 016956            3 FD-CNAKNPT-WASVTYGIFLCIDCSAVHRSL   32 (380)
Q Consensus         3 ~D-Cga~~P~-WaSv~~GiflC~~Csg~HR~L   32 (380)
                      +| |+.--|. |.--+-.-++|.-| |.||++
T Consensus        22 ~DGCgEFm~~~g~eg~~~al~CaAC-gCHRnF   52 (60)
T PF04770_consen   22 VDGCGEFMPSPGEEGTPEALKCAAC-GCHRNF   52 (60)
T ss_pred             cccccccccCCCCCCCcccceeccc-Ccchhc
Confidence            44 8877777 76667788999999 899986


No 57 
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers. DNA-binding domain of Ecdysone receptor (EcR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with highly degenerate pseudo-palindromic response elements, resembling inverted repeats of 5'-AGGTCA-3' separated by 1 bp, upstream of the target gene and modulates the rate of transcriptional initiation. EcR is present only in invertebrates and regulates the expression of a large number of genes during development and reproduction. EcR functions as a heterodimer by partnering with ultraspiracle protein (USP), the ortholog of the vertebrate retinoid X receptor (RXR). The natural ligands of EcR are ecdysteroids, the endogenous steroidal hormones found in invertebrates. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcRs h
Probab=21.66  E-value=51  Score=27.17  Aligned_cols=27  Identities=22%  Similarity=0.711  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.-   ...||++.|..|.++.|-
T Consensus         4 C~VCg~~a~---g~hyGv~sC~aCk~FFRR   30 (91)
T cd07161           4 CLVCGDRAS---GYHYNALTCEGCKGFFRR   30 (91)
T ss_pred             CeeCCCcCc---ceEECceeehhhHHHHHH
Confidence            777886443   468999999999998874


No 58 
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=21.64  E-value=49  Score=25.81  Aligned_cols=27  Identities=30%  Similarity=0.755  Sum_probs=21.0

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.-   ...||++.|..|.++.|-
T Consensus         1 C~VCg~~~~---g~hyGv~~C~aC~~FFRR   27 (73)
T cd07158           1 CKVCGDKAS---GFHYGVHSCEGCKGFFRR   27 (73)
T ss_pred             CcccCccCc---ceEECcchhhHHHHHHhh
Confidence            566776443   468999999999998874


No 59 
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=21.62  E-value=35  Score=26.34  Aligned_cols=27  Identities=30%  Similarity=0.593  Sum_probs=18.2

Q ss_pred             CCCCCCCCCCCeeEeccceeecccchhhhhcC
Q 016956            1 MCFDCNAKNPTWASVTYGIFLCIDCSAVHRSL   32 (380)
Q Consensus         1 ~C~DCga~~P~WaSv~~GiflC~~Csg~HR~L   32 (380)
                      +|.|||+.|--=   .--++-|.+|  -||.|
T Consensus        22 iCgdC~~en~lk---~~D~irCReC--G~RIl   48 (62)
T KOG3507|consen   22 ICGDCGQENTLK---RGDVIRCREC--GYRIL   48 (62)
T ss_pred             Eecccccccccc---CCCcEehhhc--chHHH
Confidence            599999987421   2346789999  45553


No 60 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=20.93  E-value=46  Score=27.33  Aligned_cols=27  Identities=26%  Similarity=0.827  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.   ....||+..|..|.++.|-
T Consensus         9 C~VCg~~a---~g~hyGv~sC~aCk~FFRR   35 (90)
T cd07169           9 CLICGDRA---TGLHYGIISCEGCKGFFKR   35 (90)
T ss_pred             CeecCCcC---cceEECcceehhhHHHHHH
Confidence            77788643   4578999999999998874


No 61 
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=20.00  E-value=47  Score=26.82  Aligned_cols=27  Identities=22%  Similarity=0.733  Sum_probs=21.8

Q ss_pred             CCCCCCCCCCeeEeccceeecccchhhhhc
Q 016956            2 CFDCNAKNPTWASVTYGIFLCIDCSAVHRS   31 (380)
Q Consensus         2 C~DCga~~P~WaSv~~GiflC~~Csg~HR~   31 (380)
                      |.-||.+.   ....||++.|..|.++.|-
T Consensus         6 C~VCg~~a---~g~hyGv~sC~aCk~FFRR   32 (82)
T cd07173           6 CLICGDEA---SGCHYGALTCGSCKVFFKR   32 (82)
T ss_pred             CeecCCcC---cceEECcchhhhHHHHHHH
Confidence            77788644   3578999999999998875


Done!