Citrus Sinensis ID: 016970

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38

MKGFREKAGASKCFSKSTPDTPNRSLASVGSELGSSETVKRLVTAGSMRRIHERVLGPSRTGISSSTSDIWLLGVCHKIAQDEALGDAAGNNGLAEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPWRKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALARCQRAETGLGCQSLPMAIYVVSGDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTFTFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSDVIRHIHLDSIDPSLAIGFYCRDKGLLVTFE

ccccEECccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHccccccccccccccccEEEcccEEccccccccccccccccHHHHHHHcHHcEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccccEEEEECcccccccccccEEECcccccccccccccccccccEEEEEEcccccccccccHHHHHHHHHccccccEEEccccccEEEEEEEEcccEEEEccccccccccccccccccccccccccccccccccccccccEEEEEEccHHHHHHcc

*******************************************TAGSMRRIHERVLGPSR****SSTSDIWLLGVCHKIAQ********GNNGLAEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPWRKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALARCQRAETGLGCQSLPMAIYVVSGDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTFTFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSDVIRHIHLDSIDPSLAIGFYCRDKGLLVTFE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cysteine protease ATG4	Cysteine protease required for autophagy, which is able to cleave the C-terminal part of ATG8 that may be subsequently converted to a smaller form, with a revealed C-terminal glycine. The C-terminal glycine of ATG8 is conjugated to phosphatidylethanolamine by an amide bond. This conjugated form has the capacity for the binding to autophagosomes.	probable	A2Q1V6
Cysteine protease ATG4a	Cysteine protease required for autophagy, which is able to cleave the C-terminal part of ATG8 that may be subsequently converted to a smaller form, with a revealed C-terminal glycine. ATG8 is then activated by ATG7 and is subsequently attached to ATG3, another E2-like enzyme, after which the C-terminal glycine of ATG8 is conjugated to phosphatidylethanolamine by an amide bond. This conjugated form has the capacity for the binding to autophagosomes.	probable	Q8S929
Cysteine protease ATG4B	Cysteine protease required for autophagy, which is able to cleave the C-terminal part of ATG8 that may be subsequently converted to a smaller form, with a revealed C-terminal glycine. The C-terminal glycine of ATG8 is conjugated to phosphatidylethanolamine by an amide bond. This conjugated form has the capacity for the binding to autophagosomes.	probable	Q7XPW8

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CY7, chain A
Confidence level:very confident
Coverage over the Query: 59-82,94-378
View the alignment between query and template
View the model in PyMOL