Query         016971
Match_columns 379
No_of_seqs    190 out of 334
Neff          3.6 
Searched_HMMs 46136
Date          Fri Mar 29 04:28:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/016971.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/016971hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03110 SBP:  SBP domain;  Int 100.0 5.8E-40 1.3E-44  264.9  -1.0   78   87-164     1-78  (79)
  2 PF14901 Jiv90:  Cleavage induc  44.1     9.4  0.0002   32.7   0.6   18  125-142    26-43  (94)
  3 PRK06424 transcription factor;  44.1      13 0.00028   33.6   1.5   21  117-137    14-34  (144)
  4 PRK00241 nudC NADH pyrophospha  34.2      14  0.0003   35.9   0.1   37  100-137    92-128 (256)
  5 PF14776 UNC-79:  Cation-channe  33.2      22 0.00047   38.6   1.3   27  107-133   262-297 (525)
  6 TIGR03831 YgiT_finger YgiT-typ  22.4      45 0.00097   23.1   1.0   20  115-134    21-40  (46)
  7 TIGR00270 conserved hypothetic  21.4      53  0.0012   29.9   1.5   22  115-136    13-34  (154)
  8 PF12108 SF3a60_bindingd:  Spli  21.4      18 0.00039   24.8  -1.2   11   97-107    16-26  (28)
  9 COG2816 NPY1 NTP pyrophosphohy  21.0      38 0.00081   34.1   0.5   36  100-136   104-139 (279)
 10 PF05485 THAP:  THAP domain;  I  17.8      65  0.0014   25.0   1.1   14  106-119    48-61  (84)

No 1  
>PF03110 SBP:  SBP domain;  InterPro: IPR004333 The SBP plant protein domain is a sequence specific DNA-binding domain []. Proteins with this domain probably function as transcription factors involved in the control of early flower development. The domain contains 10 conserved cysteine and histidine residues that probably are zinc ligands.; GO: 0003677 DNA binding, 0005634 nucleus; PDB: 1UL4_A 1WJ0_A 1UL5_A.
Probab=100.00  E-value=5.8e-40  Score=264.92  Aligned_cols=78  Identities=62%  Similarity=1.141  Sum_probs=63.2

Q ss_pred             ceeeCCCccccccccccccccccchhhcCCCeEeEcCeeehhhhhccccccccccccchhHHHHHHhHHHhhhcCCCC
Q 016971           87 SCLVDGCDSDLSNCRDYHRRHKVCELHSKTPQVLICGQKQRFCQQCSRFHCLEEFDEGKRSCRKRLDGHNRRRRKPQP  164 (379)
Q Consensus        87 ~CqV~GC~~dLs~~k~Y~rR~rVCe~H~ka~~V~v~G~~qRFCQQC~rFH~L~eFD~~kRSCR~rL~~hn~RRRk~q~  164 (379)
                      +||||||++||+.+|+||+||||||.|+||++|+++|+++||||||+|||+|+||||+|||||++|++||+||||.++
T Consensus         1 ~CqV~gC~~dL~~~k~Y~rR~rICe~H~ka~~V~~~G~~~RFCQQC~rfh~l~eFdg~kRSCr~~L~~h~~RRr~~~~   78 (79)
T PF03110_consen    1 RCQVDGCGADLSGAKEYHRRYRICEEHAKAPVVVVDGVEQRFCQQCGRFHPLSEFDGGKRSCRARLARHNERRRKRQQ   78 (79)
T ss_dssp             C-SSTTEE-EETS--SSCCCTT--HHHHTHSEEEETTEEEEE-TTTSSEEETTCB-SSTTSBSTTTT-SSS---S-S-
T ss_pred             CCcCCCCCcchhhhHHHhhccCcchhhcCCCeEEECChhHHHHHHHHcCCCHHHHcchhhhHHHHHHHHHHHhccccC
Confidence            699999999999999999999999999999999999999999999999999999999999999999999999999875


No 2  
>PF14901 Jiv90:  Cleavage inducing molecular chaperone
Probab=44.12  E-value=9.4  Score=32.74  Aligned_cols=18  Identities=39%  Similarity=0.672  Sum_probs=14.6

Q ss_pred             eehhhhhccccccccccc
Q 016971          125 KQRFCQQCSRFHCLEEFD  142 (379)
Q Consensus       125 ~qRFCQQC~rFH~L~eFD  142 (379)
                      .-|+||+|..+|+..|=|
T Consensus        26 ~AR~C~~C~~~H~Ak~gD   43 (94)
T PF14901_consen   26 AARYCQDCKIRHPAKEGD   43 (94)
T ss_pred             hhHhHHHhhhhcccccCC
Confidence            469999999999876544


No 3  
>PRK06424 transcription factor; Provisional
Probab=44.06  E-value=13  Score=33.58  Aligned_cols=21  Identities=29%  Similarity=0.721  Sum_probs=18.7

Q ss_pred             CeEeEcCeeehhhhhcccccc
Q 016971          117 PQVLICGQKQRFCQQCSRFHC  137 (379)
Q Consensus       117 ~~V~v~G~~qRFCQQC~rFH~  137 (379)
                      ..|+|+|.+.+-|..|.+|=.
T Consensus        14 ~~v~ieg~~l~vC~~Ca~~G~   34 (144)
T PRK06424         14 TKVMIDGAILNVCDDCAKFGT   34 (144)
T ss_pred             eEEEEcCeeeehhHHHHHcCC
Confidence            578999999999999998854


No 4  
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=34.17  E-value=14  Score=35.86  Aligned_cols=37  Identities=14%  Similarity=0.316  Sum_probs=28.9

Q ss_pred             ccccccccccchhhcCCCeEeEcCeeehhhhhcccccc
Q 016971          100 CRDYHRRHKVCELHSKTPQVLICGQKQRFCQQCSRFHC  137 (379)
Q Consensus       100 ~k~Y~rR~rVCe~H~ka~~V~v~G~~qRFCQQC~rFH~  137 (379)
                      +..+|++||-|..+-....+. .+...|.|..|++.|-
T Consensus        92 l~~w~~~~~fC~~CG~~~~~~-~~~~~~~C~~c~~~~y  128 (256)
T PRK00241         92 LAEFYRSHRFCGYCGHPMHPS-KTEWAMLCPHCRERYY  128 (256)
T ss_pred             HHHHhhcCccccccCCCCeec-CCceeEECCCCCCEEC
Confidence            468999999999988765554 5556788999997664


No 5  
>PF14776 UNC-79:  Cation-channel complex subunit UNC-79
Probab=33.20  E-value=22  Score=38.59  Aligned_cols=27  Identities=33%  Similarity=0.607  Sum_probs=20.3

Q ss_pred             cccchhhcCCCeEeE---------cCeeehhhhhcc
Q 016971          107 HKVCELHSKTPQVLI---------CGQKQRFCQQCS  133 (379)
Q Consensus       107 ~rVCe~H~ka~~V~v---------~G~~qRFCQQC~  133 (379)
                      +|-|.-+.|..+|+-         +++..|+||||.
T Consensus       262 nK~C~S~~k~AvvtCFS~eCt~~~gn~PiRlC~~Ch  297 (525)
T PF14776_consen  262 NKNCRSSDKSAVVTCFSTECTSYNGNRPIRLCQQCH  297 (525)
T ss_pred             CCCCcCCCCCeEEEEechhhccccCCCcchhHHHHh
Confidence            456666667666653         788999999997


No 6  
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=22.41  E-value=45  Score=23.07  Aligned_cols=20  Identities=20%  Similarity=0.400  Sum_probs=17.4

Q ss_pred             CCCeEeEcCeeehhhhhccc
Q 016971          115 KTPQVLICGQKQRFCQQCSR  134 (379)
Q Consensus       115 ka~~V~v~G~~qRFCQQC~r  134 (379)
                      +...+++.++...+|.+|+.
T Consensus        21 ~~~~~~i~~vp~~~C~~CGE   40 (46)
T TIGR03831        21 GGELIVIENVPALVCPQCGE   40 (46)
T ss_pred             CCEEEEEeCCCccccccCCC
Confidence            56778899999999999994


No 7  
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=21.40  E-value=53  Score=29.92  Aligned_cols=22  Identities=27%  Similarity=0.673  Sum_probs=19.0

Q ss_pred             CCCeEeEcCeeehhhhhccccc
Q 016971          115 KTPQVLICGQKQRFCQQCSRFH  136 (379)
Q Consensus       115 ka~~V~v~G~~qRFCQQC~rFH  136 (379)
                      +.-.|.|+|.+..-|..|.+|=
T Consensus        13 ~~~~v~iega~l~vC~~C~k~G   34 (154)
T TIGR00270        13 KGFKIVIEGSEMTVCGECRKFG   34 (154)
T ss_pred             CCeEEEEcCeEEehhhhHHhcC
Confidence            3457889999999999999883


No 8  
>PF12108 SF3a60_bindingd:  Splicing factor SF3a60 binding domain;  InterPro: IPR021966  This domain is found in eukaryotes. This domain is about 30 amino acids in length. This domain has a single completely conserved residue Y that may be functionally important. SF3a60 makes up the SF3a complex with SF3a66 and SF3a120. This domain is the binding site of SF3a60 for SF3a120. The SF3a complex is part of the spliceosome, a protein complex involved in splicing mRNA after transcription. ; PDB: 2DT7_A.
Probab=21.39  E-value=18  Score=24.80  Aligned_cols=11  Identities=45%  Similarity=0.918  Sum_probs=7.2

Q ss_pred             ccccccccccc
Q 016971           97 LSNCRDYHRRH  107 (379)
Q Consensus        97 Ls~~k~Y~rR~  107 (379)
                      |..+|+||+||
T Consensus        16 lk~Ike~Hrr~   26 (28)
T PF12108_consen   16 LKEIKEYHRRY   26 (28)
T ss_dssp             HHHHHHHHHS-
T ss_pred             HHHHHHHHHhC
Confidence            55677788776


No 9  
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=20.99  E-value=38  Score=34.10  Aligned_cols=36  Identities=25%  Similarity=0.454  Sum_probs=29.4

Q ss_pred             ccccccccccchhhcCCCeEeEcCeeehhhhhccccc
Q 016971          100 CRDYHRRHKVCELHSKTPQVLICGQKQRFCQQCSRFH  136 (379)
Q Consensus       100 ~k~Y~rR~rVCe~H~ka~~V~v~G~~qRFCQQC~rFH  136 (379)
                      +-++|++||.|.. .-+++...+|...|-|++|+.-|
T Consensus       104 l~~w~~~~RFCg~-CG~~~~~~~~g~~~~C~~cg~~~  139 (279)
T COG2816         104 LLEWYRSHRFCGR-CGTKTYPREGGWARVCPKCGHEH  139 (279)
T ss_pred             HHHHHhhCcCCCC-CCCcCccccCceeeeCCCCCCcc
Confidence            4578999999985 45677888899999999998554


No 10 
>PF05485 THAP:  THAP domain;  InterPro: IPR006612 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. The THAP domain is an ~90-residue domain restricted to animals, which is shared between the THAP family of cellular DNA-binding proteins, and transposases from mobile genomic parasites. The defined THAP domain includes: a C2CH signature (consensus: C-x(2,4)-C-x(35,50)-C-x(2)-H); three additional key residues that are strictly conserved in all THAP domains that have been found to date (THAP1 amino acids P26, W36, F58); a C-terminal AVPTIF box; and several other conserved amino acid positions with distinct physicochemical properties (e.g. hydrophobic and polar). The THAP domain can be found in one or more copies and can be associated with other domains, such as the C2H2-type zinc finger. The THAP domain is supposed to be a DNA-binding domain (DBD) [, ].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding; PDB: 3KDE_C 2D8R_A 2JM3_A 2KO0_A 2JTG_A 2L1G_A.
Probab=17.76  E-value=65  Score=25.01  Aligned_cols=14  Identities=14%  Similarity=0.482  Sum_probs=9.0

Q ss_pred             ccccchhhcCCCeE
Q 016971          106 RHKVCELHSKTPQV  119 (379)
Q Consensus       106 R~rVCe~H~ka~~V  119 (379)
                      ..+||..|.....+
T Consensus        48 ~~~ICs~HF~~~~~   61 (84)
T PF05485_consen   48 NSRICSRHFEPDDF   61 (84)
T ss_dssp             TSEEEGGGSTGGGB
T ss_pred             CccchhhhCchhhc
Confidence            45777777765444


Done!