Citrus Sinensis ID: 016987
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 379 | ||||||
| 225453818 | 513 | PREDICTED: tricalbin-1 [Vitis vinifera] | 0.875 | 0.647 | 0.885 | 1e-174 | |
| 356505439 | 535 | PREDICTED: extended synaptotagmin-2-like | 0.875 | 0.620 | 0.876 | 1e-172 | |
| 356520501 | 524 | PREDICTED: extended synaptotagmin-2-like | 0.875 | 0.633 | 0.870 | 1e-171 | |
| 255541372 | 515 | calcium lipid binding protein, putative | 0.878 | 0.646 | 0.855 | 1e-171 | |
| 449454506 | 507 | PREDICTED: synaptotagmin-5-like [Cucumis | 0.878 | 0.656 | 0.852 | 1e-170 | |
| 449498883 | 507 | PREDICTED: LOW QUALITY PROTEIN: synaptot | 0.878 | 0.656 | 0.849 | 1e-169 | |
| 224127446 | 500 | integral membrane single C2 domain prote | 0.878 | 0.666 | 0.837 | 1e-168 | |
| 224063933 | 500 | integral membrane single C2 domain prote | 0.878 | 0.666 | 0.837 | 1e-168 | |
| 357514731 | 513 | Extended synaptotagmin-3 [Medicago trunc | 0.878 | 0.649 | 0.852 | 1e-168 | |
| 356532074 | 535 | PREDICTED: extended synaptotagmin-2-like | 0.875 | 0.620 | 0.840 | 1e-166 |
| >gi|225453818|ref|XP_002276807.1| PREDICTED: tricalbin-1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 617 bits (1591), Expect = e-174, Method: Compositional matrix adjust.
Identities = 294/332 (88%), Positives = 317/332 (95%)
Query: 1 MGLISGVFMGMIFGIALMAGWRHMMRYRSTKRIAKAADIKILGSLNRDDLKKICGDNFPV 60
MGLISG+ MG IFGIALMAGW HMMRYRS KR+AKA DIK+LGSLNR+DLKKICGDNFP
Sbjct: 1 MGLISGILMGTIFGIALMAGWVHMMRYRSIKRVAKAVDIKLLGSLNREDLKKICGDNFPE 60
Query: 61 WISFPVYEQVKWLNKELSKLWPFVADAAELVIKESVEPLLEEYRPPGITSLKFSKLSLGN 120
WISFPVYEQVKWLNK+L+KLWPFVADAA LVI+ESVEPLLE+YRPPGITSLKFSKLSLGN
Sbjct: 61 WISFPVYEQVKWLNKQLTKLWPFVADAATLVIRESVEPLLEDYRPPGITSLKFSKLSLGN 120
Query: 121 VAPKIEGIRVQSLKQGQITMDIDFRWGGDPSIILGVEAAMVASIPIQLKDLQVFTVIRVI 180
VAPKIEGIRVQSLK+GQI MDID RWGGDPSIIL VEAA+VASIPIQLKDLQVFTV RVI
Sbjct: 121 VAPKIEGIRVQSLKKGQIIMDIDLRWGGDPSIILAVEAALVASIPIQLKDLQVFTVARVI 180
Query: 181 FQLAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQW 240
FQLAEEIPCISAV+VALLSEPKPRIDYTLKAVGGSLTA+PGI+DMIDDTV++IITDMLQW
Sbjct: 181 FQLAEEIPCISAVIVALLSEPKPRIDYTLKAVGGSLTALPGISDMIDDTVNTIITDMLQW 240
Query: 241 PHRIVVPIGGIPVDTSELELKPQGKVAVTIVKANNLKNMEMIGKSDPYAVVHIKPLFKVK 300
PHRIVVPIGG+PVDTSELELKPQGK+ +TIVKAN+LKNMEMIGKSDPY VVHI+PLFK+K
Sbjct: 241 PHRIVVPIGGMPVDTSELELKPQGKLTLTIVKANDLKNMEMIGKSDPYVVVHIRPLFKIK 300
Query: 301 TNVVDNNLNPVWNQTFELIAEDKETQSLIFEV 332
T V++NNLNPVWNQTFELIAEDKETQSLI EV
Sbjct: 301 TKVIENNLNPVWNQTFELIAEDKETQSLILEV 332
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356505439|ref|XP_003521498.1| PREDICTED: extended synaptotagmin-2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356520501|ref|XP_003528900.1| PREDICTED: extended synaptotagmin-2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255541372|ref|XP_002511750.1| calcium lipid binding protein, putative [Ricinus communis] gi|223548930|gb|EEF50419.1| calcium lipid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449454506|ref|XP_004144995.1| PREDICTED: synaptotagmin-5-like [Cucumis sativus] gi|449474835|ref|XP_004154298.1| PREDICTED: synaptotagmin-5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449498883|ref|XP_004160660.1| PREDICTED: LOW QUALITY PROTEIN: synaptotagmin-5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224127446|ref|XP_002320076.1| integral membrane single C2 domain protein [Populus trichocarpa] gi|222860849|gb|EEE98391.1| integral membrane single C2 domain protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224063933|ref|XP_002301308.1| integral membrane single C2 domain protein [Populus trichocarpa] gi|222843034|gb|EEE80581.1| integral membrane single C2 domain protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357514731|ref|XP_003627654.1| Extended synaptotagmin-3 [Medicago truncatula] gi|355521676|gb|AET02130.1| Extended synaptotagmin-3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356532074|ref|XP_003534599.1| PREDICTED: extended synaptotagmin-2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 379 | ||||||
| TAIR|locus:2100992 | 510 | NTMC2T4 [Arabidopsis thaliana | 0.875 | 0.650 | 0.792 | 2.2e-146 | |
| TAIR|locus:2201036 | 560 | NTMC2T2.1 "AT1G05500" [Arabido | 0.868 | 0.587 | 0.424 | 4.1e-72 | |
| TAIR|locus:2184931 | 569 | SYTD "AT5G11100" [Arabidopsis | 0.868 | 0.578 | 0.424 | 1.1e-71 | |
| TAIR|locus:2146688 | 540 | SYTC "AT5G04220" [Arabidopsis | 0.833 | 0.585 | 0.324 | 6.2e-46 | |
| TAIR|locus:2198581 | 537 | SYTB "AT1G20080" [Arabidopsis | 0.849 | 0.599 | 0.309 | 1.7e-43 | |
| WB|WBGene00020443 | 713 | esyt-2 [Caenorhabditis elegans | 0.704 | 0.374 | 0.294 | 2.9e-33 | |
| MGI|MGI:1344426 | 1092 | Esyt1 "extended synaptotagmin- | 0.839 | 0.291 | 0.287 | 5.8e-32 | |
| RGD|3053 | 1088 | Esyt1 "extended synaptotagmin- | 0.839 | 0.292 | 0.287 | 1.5e-31 | |
| UNIPROTKB|Q9BSJ8 | 1104 | ESYT1 "Extended synaptotagmin- | 0.836 | 0.287 | 0.282 | 8.9e-31 | |
| UNIPROTKB|A0FGR9 | 886 | ESYT3 "Extended synaptotagmin- | 0.815 | 0.348 | 0.293 | 1.2e-30 |
| TAIR|locus:2100992 NTMC2T4 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1430 (508.4 bits), Expect = 2.2e-146, P = 2.2e-146
Identities = 264/333 (79%), Positives = 307/333 (92%)
Query: 1 MGLISGVFMGMIFGIALMAGWRHMMRYRSTKRIAKAADIKILGSLNRDDLKKICGDNFPV 60
MGLISG+ G+IFG+ALMAGW MM +RS+KR+AKA D+K+LGSL+RDDLKKICGDNFP
Sbjct: 1 MGLISGILFGIIFGVALMAGWSRMMTHRSSKRVAKAVDMKLLGSLSRDDLKKICGDNFPQ 60
Query: 61 WISFPVYEQVKWLNKELSKLWPFVADAAELVIKESVEPLLEEYRPPGITSLKFSKLSLGN 120
WISFP +EQVKWLNK LSK+WP++A+AA +VI++SVEPLLE+YRPPGITSLKFSKL+LGN
Sbjct: 61 WISFPAFEQVKWLNKLLSKMWPYIAEAATMVIRDSVEPLLEDYRPPGITSLKFSKLTLGN 120
Query: 121 VAPKIEGIRVQSLKQGQITMDIDFRWGGDPSIILGVEAAMVASIPIQLKDLQVFTVIRVI 180
VAPKIEGIRVQS K+GQ+TMD+D RWGGDP+I+LGV A+VASIPIQLKDLQVFTV RVI
Sbjct: 121 VAPKIEGIRVQSFKEGQVTMDVDLRWGGDPNIVLGV-TALVASIPIQLKDLQVFTVARVI 179
Query: 181 FQLAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQW 240
FQLA+EIPCISAVVVALL+EPKPRIDYTLKAVGGSLTAIPG++DMIDDTVD+I+ DMLQW
Sbjct: 180 FQLADEIPCISAVVVALLAEPKPRIDYTLKAVGGSLTAIPGLSDMIDDTVDTIVKDMLQW 239
Query: 241 PHRIVVPIGGIPVDTSELELKPQGKVAVTIVKANNLKNMEMIGKSDPYAVVHIKPLFKVK 300
PHRIVVPIGGIPVD S+LELKPQGK+ VT+VKA NLKN E+IGKSDPYA ++I+P+FK K
Sbjct: 240 PHRIVVPIGGIPVDLSDLELKPQGKLIVTVVKATNLKNKELIGKSDPYATIYIRPVFKYK 299
Query: 301 TNVVDNNLNPVWNQTFELIAEDKETQSLIFEVY 333
T ++NNLNPVW+QTFELIAEDKETQSL EV+
Sbjct: 300 TKAIENNLNPVWDQTFELIAEDKETQSLTVEVF 332
|
|
| TAIR|locus:2201036 NTMC2T2.1 "AT1G05500" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2184931 SYTD "AT5G11100" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146688 SYTC "AT5G04220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2198581 SYTB "AT1G20080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00020443 esyt-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1344426 Esyt1 "extended synaptotagmin-like protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|3053 Esyt1 "extended synaptotagmin-like protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BSJ8 ESYT1 "Extended synaptotagmin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A0FGR9 ESYT3 "Extended synaptotagmin-3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00026294001 | SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (513 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 379 | |||
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 6e-31 | |
| cd00030 | 102 | cd00030, C2, C2 domain | 1e-21 | |
| pfam00168 | 85 | pfam00168, C2, C2 domain | 5e-20 | |
| smart00239 | 101 | smart00239, C2, Protein kinase C conserved region | 2e-18 | |
| cd08391 | 121 | cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir | 9e-15 | |
| cd00276 | 134 | cd00276, C2B_Synaptotagmin, C2 domain second repea | 1e-12 | |
| cd04045 | 120 | cd04045, C2C_Tricalbin-like, C2 domain third repea | 7e-12 | |
| cd04051 | 125 | cd04051, C2_SRC2_like, C2 domain present in Soybea | 2e-11 | |
| cd04040 | 115 | cd04040, C2D_Tricalbin-like, C2 domain fourth repe | 3e-11 | |
| cd04044 | 124 | cd04044, C2A_Tricalbin-like, C2 domain first repea | 9e-11 | |
| cd04024 | 128 | cd04024, C2A_Synaptotagmin-like, C2 domain first r | 2e-10 | |
| cd08403 | 134 | cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s | 2e-10 | |
| cd08405 | 136 | cd08405, C2B_Synaptotagmin-7, C2 domain second rep | 3e-10 | |
| cd08385 | 124 | cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain | 3e-10 | |
| cd08402 | 136 | cd08402, C2B_Synaptotagmin-1, C2 domain second rep | 4e-10 | |
| cd04048 | 120 | cd04048, C2A_Copine, C2 domain first repeat in Cop | 6e-10 | |
| cd04038 | 145 | cd04038, C2_ArfGAP, C2 domain present in Arf GTPas | 2e-09 | |
| cd04036 | 119 | cd04036, C2_cPLA2, C2 domain present in cytosolic | 3e-09 | |
| cd04026 | 131 | cd04026, C2_PKC_alpha_gamma, C2 domain in Protein | 1e-08 | |
| cd04009 | 133 | cd04009, C2B_Munc13-like, C2 domain second repeat | 3e-08 | |
| cd04035 | 123 | cd04035, C2A_Rabphilin_Doc2, C2 domain first repea | 5e-08 | |
| cd04043 | 126 | cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma | 5e-08 | |
| cd04030 | 127 | cd04030, C2C_KIAA1228, C2 domain third repeat pres | 7e-08 | |
| cd04031 | 125 | cd04031, C2A_RIM1alpha, C2 domain first repeat con | 1e-07 | |
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 2e-07 | |
| cd08377 | 119 | cd08377, C2C_MCTP_PRT, C2 domain third repeat foun | 2e-07 | |
| cd04047 | 110 | cd04047, C2B_Copine, C2 domain second repeat in Co | 4e-07 | |
| cd08386 | 125 | cd08386, C2A_Synaptotagmin-7, C2A domain first rep | 6e-07 | |
| cd04027 | 127 | cd04027, C2B_Munc13, C2 domain second repeat in Mu | 6e-07 | |
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 2e-06 | |
| cd08373 | 127 | cd08373, C2A_Ferlin, C2 domain first repeat in Fer | 2e-06 | |
| cd04042 | 121 | cd04042, C2A_MCTP_PRT, C2 domain first repeat foun | 3e-06 | |
| cd08375 | 136 | cd08375, C2_Intersectin, C2 domain present in Inte | 4e-06 | |
| cd04041 | 111 | cd04041, C2A_fungal, C2 domain first repeat; funga | 4e-06 | |
| cd08382 | 123 | cd08382, C2_Smurf-like, C2 domain present in Smad | 5e-06 | |
| cd08384 | 133 | cd08384, C2B_Rabphilin_Doc2, C2 domain second repe | 6e-06 | |
| cd08678 | 126 | cd08678, C2_C21orf25-like, C2 domain found in the | 7e-06 | |
| cd04032 | 127 | cd04032, C2_Perforin, C2 domain of Perforin | 8e-06 | |
| cd08410 | 135 | cd08410, C2B_Synaptotagmin-17, C2 domain second re | 8e-06 | |
| cd04037 | 124 | cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer | 8e-06 | |
| cd04022 | 127 | cd04022, C2A_MCTP_PRT_plant, C2 domain first repea | 1e-05 | |
| cd08388 | 128 | cd08388, C2A_Synaptotagmin-4-11, C2A domain first | 1e-05 | |
| cd00275 | 128 | cd00275, C2_PLC_like, C2 domain present in Phospho | 2e-05 | |
| cd08378 | 121 | cd08378, C2B_MCTP_PRT_plant, C2 domain second repe | 8e-05 | |
| cd08404 | 136 | cd08404, C2B_Synaptotagmin-4, C2 domain second rep | 1e-04 | |
| cd08376 | 116 | cd08376, C2B_MCTP_PRT, C2 domain second repeat fou | 2e-04 | |
| cd08676 | 153 | cd08676, C2A_Munc13-like, C2 domain first repeat i | 2e-04 | |
| cd04015 | 158 | cd04015, C2_plant_PLD, C2 domain present in plant | 3e-04 | |
| cd04033 | 133 | cd04033, C2_NEDD4_NEDD4L, C2 domain present in the | 6e-04 | |
| cd04021 | 125 | cd04021, C2_E3_ubiquitin_ligase, C2 domain present | 8e-04 | |
| cd04052 | 111 | cd04052, C2B_Tricalbin-like, C2 domain second repe | 8e-04 | |
| cd04046 | 126 | cd04046, C2_Calpain, C2 domain present in Calpain | 0.001 | |
| cd04050 | 105 | cd04050, C2B_Synaptotagmin-like, C2 domain second | 0.002 |
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
Score = 124 bits (313), Expect = 6e-31
Identities = 90/295 (30%), Positives = 131/295 (44%), Gaps = 32/295 (10%)
Query: 67 YEQVKWLNKELSKLWPFVADAAELVIKESVEPLLEEYRPPGITSLKFSKLSLGNVAPKIE 126
YE V+WLN L K WP + + + + V L E P I +L + +LG+ P+I+
Sbjct: 220 YESVEWLNTFLQKFWPIIEPSISQQVVDQVNQQLAEAIPSFIDALALDEFTLGSKPPRID 279
Query: 127 GIRV-QSLKQGQITMDIDF---------------RWGGDPSIILGVEAAM---VASIPIQ 167
GIR S + + MD+DF R +P I L V+ ++PI
Sbjct: 280 GIRSYPSTESDTVVMDVDFSFTPHDISDVTATSARASVNPKISLVVKKGKSFGSFTLPIL 339
Query: 168 LKDLQVFTVIRVIFQLAEEIPCISAVVVALLSEPKPRIDYTLKAVGGS-----LTAIPGI 222
++DL +RV +L + P I V LL P D+ L +GG + AIPG+
Sbjct: 340 VEDLFFKGRVRVRVELMSKYPFIKTVSFQLLE--VPEFDFILVPLGGDFFGVDIFAIPGL 397
Query: 223 ADMIDDTVDSIITDMLQWPHRIVVPIGGIPVDTSELELKPQGKVAVTIVKANNLKNMEMI 282
+ I + ++S + ML P+ + + I I S + G V V I A LK +
Sbjct: 398 SRFIQEIINSTLGPMLLPPNSLTIDISQIMAGDSGTAI---GVVEVKIKSAEGLKKSDST 454
Query: 283 --GKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVYIF 335
G DPY V KT V N LNPVWN+TF ++ T L +Y F
Sbjct: 455 INGTVDPYITVTFSDRVIGKTRVKKNTLNPVWNETFYILLN-SFTDPLNLSLYDF 508
|
Length = 1227 |
| >gnl|CDD|175973 cd00030, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|215765 pfam00168, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin | Back alignment and domain information |
|---|
| >gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175982 cd04015, C2_plant_PLD, C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 379 | |||
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 100.0 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 99.81 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 99.73 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 99.73 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 99.72 | |
| KOG1030 | 168 | consensus Predicted Ca2+-dependent phospholipid-bi | 99.71 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 99.7 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 99.69 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 99.69 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 99.68 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 99.68 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 99.67 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 99.67 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 99.67 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 99.66 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 99.66 | |
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 99.65 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 99.65 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 99.64 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 99.64 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 99.64 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 99.64 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 99.63 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 99.63 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 99.62 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 99.62 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 99.61 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 99.61 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 99.61 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 99.6 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 99.6 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 99.6 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 99.59 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 99.59 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 99.59 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 99.58 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 99.58 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 99.58 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 99.58 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 99.57 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 99.57 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 99.57 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 99.56 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 99.55 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 99.55 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 99.55 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 99.55 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 99.54 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 99.54 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 99.53 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 99.53 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 99.53 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 99.53 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 99.52 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 99.52 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 99.52 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 99.51 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 99.5 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 99.49 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 99.49 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 99.48 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 99.48 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 99.48 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 99.48 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 99.48 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 99.48 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 99.48 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 99.47 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 99.47 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 99.47 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 99.47 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 99.47 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 99.46 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 99.45 | |
| PLN03008 | 868 | Phospholipase D delta | 99.45 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 99.44 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 99.44 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 99.44 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 99.43 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 99.43 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 99.42 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 99.42 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 99.42 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 99.41 | |
| KOG1028 | 421 | consensus Ca2+-dependent phospholipid-binding prot | 99.41 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 99.4 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 99.39 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 99.37 | |
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 99.35 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 99.35 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 99.35 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.35 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 99.32 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 99.3 | |
| PF10296 | 91 | DUF2404: Putative integral membrane protein conser | 99.28 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 99.28 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 99.28 | |
| KOG1011 | 1283 | consensus Neurotransmitter release regulator, UNC- | 99.19 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 99.19 | |
| KOG1028 | 421 | consensus Ca2+-dependent phospholipid-binding prot | 99.03 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 98.99 | |
| PLN02270 | 808 | phospholipase D alpha | 98.98 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 98.93 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 98.92 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 98.9 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 98.89 | |
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 98.84 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 98.84 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 98.73 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 98.73 | |
| KOG1328 | 1103 | consensus Synaptic vesicle protein BAIAP3, involve | 98.68 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 98.64 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 98.59 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 98.56 | |
| KOG1031 | 1169 | consensus Predicted Ca2+-dependent phospholipid-bi | 98.54 | |
| KOG3532 | 1051 | consensus Predicted protein kinase [General functi | 98.35 | |
| KOG1328 | 1103 | consensus Synaptic vesicle protein BAIAP3, involve | 98.34 | |
| KOG1264 | 1267 | consensus Phospholipase C [Lipid transport and met | 98.33 | |
| PLN02352 | 758 | phospholipase D epsilon | 98.16 | |
| KOG1326 | 1105 | consensus Membrane-associated protein FER-1 and re | 97.96 | |
| KOG1013 | 362 | consensus Synaptic vesicle protein rabphilin-3A [I | 97.85 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 97.51 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 97.41 | |
| KOG0905 | 1639 | consensus Phosphoinositide 3-kinase [Signal transd | 97.39 | |
| KOG1013 | 362 | consensus Synaptic vesicle protein rabphilin-3A [I | 97.25 | |
| KOG1326 | 1105 | consensus Membrane-associated protein FER-1 and re | 96.99 | |
| KOG1011 | 1283 | consensus Neurotransmitter release regulator, UNC- | 96.33 | |
| cd08683 | 143 | C2_C2cd3 C2 domain found in C2 calcium-dependent d | 96.22 | |
| KOG2060 | 405 | consensus Rab3 effector RIM1 and related proteins, | 96.08 | |
| KOG1327 | 529 | consensus Copine [Signal transduction mechanisms] | 95.45 | |
| cd08684 | 103 | C2A_Tac2-N C2 domain first repeat found in Tac2-N | 94.81 | |
| KOG1265 | 1189 | consensus Phospholipase C [Lipid transport and met | 91.93 | |
| KOG1452 | 442 | consensus Predicted Rho GTPase-activating protein | 91.9 | |
| cd08398 | 158 | C2_PI3K_class_I_alpha C2 domain present in class I | 90.86 | |
| PF12416 | 340 | DUF3668: Cep120 protein; InterPro: IPR022136 This | 90.74 | |
| cd08693 | 173 | C2_PI3K_class_I_beta_delta C2 domain present in cl | 89.83 | |
| cd08695 | 189 | C2_Dock-B C2 domains found in Dedicator Of CytoKin | 88.67 | |
| cd08694 | 196 | C2_Dock-A C2 domains found in Dedicator Of CytoKin | 87.67 | |
| cd08687 | 98 | C2_PKN-like C2 domain in Protein kinase C-like (PK | 87.65 | |
| PF14429 | 184 | DOCK-C2: C2 domain in Dock180 and Zizimin proteins | 87.39 | |
| KOG2238 | 795 | consensus Uncharacterized conserved protein TEX2, | 86.25 | |
| cd08380 | 156 | C2_PI3K_like C2 domain present in phosphatidylinos | 85.6 | |
| PF15627 | 156 | CEP76-C2: CEP76 C2 domain | 85.08 | |
| PF00792 | 142 | PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I | 83.23 | |
| smart00142 | 100 | PI3K_C2 Phosphoinositide 3-kinase, region postulat | 82.98 | |
| cd08397 | 159 | C2_PI3K_class_III C2 domain present in class III p | 82.78 |
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-47 Score=388.95 Aligned_cols=271 Identities=32% Similarity=0.551 Sum_probs=243.6
Q ss_pred CCCcchHHHHHHHHhHchhhHHHHHHHHHHhHHHHHHhcCCCCcceEEEeEEecCCCCCeeeeeEEEe-cCCCeEEEEEE
Q 016987 65 PVYEQVKWLNKELSKLWPFVADAAELVIKESVEPLLEEYRPPGITSLKFSKLSLGNVAPKIEGIRVQS-LKQGQITMDID 143 (379)
Q Consensus 65 ~d~E~~eWlN~~l~~~Wp~~~~~~~~~i~~~l~~~l~~~~p~~~~~i~~~~~~lG~~pP~i~~ir~~~-~~~~~~~ld~~ 143 (379)
.|+|++||||.+|+++||.+++.+++.+.+.+|+.|.++-|+||+.+.+++||||++||||.+||.|+ +++|.+.||++
T Consensus 218 nd~ESveWLNtfL~KfW~i~eP~iSqqV~dqvn~~la~~iPsFI~~l~l~efTLGsk~PrI~~Irsyp~te~dtv~mD~~ 297 (1227)
T COG5038 218 NDYESVEWLNTFLQKFWPIIEPSISQQVVDQVNQQLAEAIPSFIDALALDEFTLGSKPPRIDGIRSYPSTESDTVVMDVD 297 (1227)
T ss_pred cchhHHHHHHHHHHhheeccChHHHHHHHHHHHHHHHhhcchhhhhhhhhhcccCCCCCceeeeeecCCCCCceEEEEee
Confidence 47899999999999999999999999999999999999999999999999999999999999999886 67899999999
Q ss_pred EEEcC---------------CCcEEEEEEee--ee-eeEEEEEEEEEEEEEEEEEEEecCCCCccceEEEEecCCCcceE
Q 016987 144 FRWGG---------------DPSIILGVEAA--MV-ASIPIQLKDLQVFTVIRVIFQLAEEIPCISAVVVALLSEPKPRI 205 (379)
Q Consensus 144 ~~~~g---------------~~~i~l~~~~~--~~-~~~~v~v~~~~~~g~~Rv~l~l~~~~P~~~~v~~sf~~~P~p~i 205 (379)
+++.. ++.|.|.++.+ ++ .++||.|+++.|.|++|++++|++..|++..++++|++. |++
T Consensus 298 ~sftP~d~sD~t~~~~r~~vn~kIsL~v~~Gk~~~~~~lPI~Vedl~f~g~~Rvr~~L~~~~PfiktV~~~Lle~--Pe~ 375 (1227)
T COG5038 298 FSFTPHDISDVTATSARASVNPKISLVVKKGKSFGSFTLPILVEDLFFKGRVRVRVELMSKYPFIKTVSFQLLEV--PEF 375 (1227)
T ss_pred eccCccchhhhhhHHHhhhcCcceeEEEEeeeeeeEEeccEEEEeeeeeEEEEEEEEecCCCcceeEEEEEEecC--cce
Confidence 99985 34577777665 34 889999999999999999999999999999999999997 899
Q ss_pred EEEeeecCc-----CcccccchHHHHHHHHHHHHhhhcccCceEEeeeCCCCcccccccccCCcEEEEEEeecccccccc
Q 016987 206 DYTLKAVGG-----SLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIGGIPVDTSELELKPQGKVAVTIVKANNLKNME 280 (379)
Q Consensus 206 df~l~~~g~-----~i~~iP~l~~~i~~~i~~~i~~~~v~P~~~~vpl~~~~~d~~~l~~~~~g~L~V~V~~A~~L~~~d 280 (379)
||.++++|+ ||+++|||++||+++|...++.++++|+.+++++...- ... ...+.|++.++|.+|++|...+
T Consensus 376 df~l~Plg~~~~g~dI~~iPGL~~fI~~~i~~~l~pml~~Pnsl~idi~~~m--~~~-s~~aIGVv~vkI~sa~~lk~~d 452 (1227)
T COG5038 376 DFILVPLGGDFFGVDIFAIPGLSRFIQEIINSTLGPMLLPPNSLTIDISQIM--AGD-SGTAIGVVEVKIKSAEGLKKSD 452 (1227)
T ss_pred eEEEEEcCCCccceeEecCccHHHHHHHHHHhhcCCeeeCCceEEEcHHHhh--ccc-cCCeeEEEEEEEeeccCccccc
Confidence 999999984 68899999999999999999999999999999996321 111 3468999999999999999888
Q ss_pred --cCCCCCcEEEEEEcCeeeEeeeccCCCCCCeEeeEEEEEecCCCCceEEEEEEEcccCCCC
Q 016987 281 --MIGKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVYIFLLFFPA 341 (379)
Q Consensus 281 --~~g~sdPyv~v~~~~~~~~~T~v~~~tlnP~Wne~f~f~v~~~~~~~L~i~V~D~d~~~~d 341 (379)
..+..|||+.+........||++.++++||+|||+|++.+... +++|.+++||.+.+++|
T Consensus 453 ~~i~~~vDpyit~~~~~r~~gkT~v~~nt~nPvwNEt~Yi~lns~-~d~L~LslyD~n~~~sd 514 (1227)
T COG5038 453 STINGTVDPYITVTFSDRVIGKTRVKKNTLNPVWNETFYILLNSF-TDPLNLSLYDFNSFKSD 514 (1227)
T ss_pred ccccCCCCceEEEEeccccCCccceeeccCCccccceEEEEeccc-CCceeEEEEeccccCCc
Confidence 5688999999997664567999999999999999999998765 78999999998887776
|
|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >PF10296 DUF2404: Putative integral membrane protein conserved region (DUF2404); InterPro: IPR019411 This is entry represents a domain of unknown function found in mitochondrial distribution and morphology proteins Mdm12 and Mdm34, and in maintenance of mitochondrial morphology protein Mmm1 | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3532 consensus Predicted protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1264 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02352 phospholipase D epsilon | Back alignment and domain information |
|---|
| >KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins | Back alignment and domain information |
|---|
| >KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1327 consensus Copine [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >KOG1265 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length | Back alignment and domain information |
|---|
| >cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins | Back alignment and domain information |
|---|
| >cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins | Back alignment and domain information |
|---|
| >cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins | Back alignment and domain information |
|---|
| >PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A | Back alignment and domain information |
|---|
| >KOG2238 consensus Uncharacterized conserved protein TEX2, contains PH domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PF15627 CEP76-C2: CEP76 C2 domain | Back alignment and domain information |
|---|
| >PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 | Back alignment and domain information |
|---|
| >smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain | Back alignment and domain information |
|---|
| >cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 379 | ||||
| 3hn8_A | 296 | Crystal Structure Of Synaptotagmin Length = 296 | 8e-06 | ||
| 1dqv_A | 296 | Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt | 9e-06 | ||
| 2chd_A | 142 | Crystal Structure Of The C2a Domain Of Rabphilin-3a | 6e-05 | ||
| 2k3h_A | 140 | Structural Determinants For Ca2+ And Pip2 Binding B | 7e-05 | ||
| 3kwt_A | 148 | Munc13-1 C2b-Domain, Calcium-Free Length = 148 | 9e-05 | ||
| 2uzp_A | 144 | Crystal Structure Of The C2 Domain Of Human Protein | 2e-04 | ||
| 1dsy_A | 139 | C2 Domain From Protein Kinase C (Alpha) Complexed W | 4e-04 | ||
| 3gpe_A | 137 | Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain | 4e-04 | ||
| 2d8k_A | 141 | Solution Structure Of The First C2 Domain Of Synapt | 6e-04 |
| >pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 | Back alignment and structure |
|
| >pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 | Back alignment and structure |
| >pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 | Back alignment and structure |
| >pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 | Back alignment and structure |
| >pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 | Back alignment and structure |
| >pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 | Back alignment and structure |
| >pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 | Back alignment and structure |
| >pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 | Back alignment and structure |
| >pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 379 | |||
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 9e-24 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 3e-23 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 3e-22 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 4e-22 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 9e-22 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 2e-21 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 4e-21 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 5e-21 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 4e-20 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 2e-19 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 2e-17 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 5e-16 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 8e-16 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 2e-15 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 4e-14 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 3e-15 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 6e-15 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 4e-14 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 7e-15 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 1e-14 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 2e-14 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 2e-14 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 3e-14 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 3e-14 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 4e-14 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 5e-14 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 5e-14 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 1e-13 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 3e-13 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 8e-13 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 1e-12 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 1e-12 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 2e-12 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 2e-12 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 7e-12 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 8e-12 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 1e-11 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 1e-11 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 1e-08 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 3e-07 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-06 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 8e-06 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 2e-05 |
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 | Back alignment and structure |
|---|
Score = 94.3 bits (235), Expect = 9e-24
Identities = 16/73 (21%), Positives = 31/73 (42%), Gaps = 1/73 (1%)
Query: 261 KPQGKVAVTIVKANNLKNMEMIGKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIA 320
P G + V +V A L++ + + DPY + + + P WN+TF
Sbjct: 7 GPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTV 66
Query: 321 EDKETQSLIFEVY 333
+ T+ L +++
Sbjct: 67 SEGTTE-LKAKIF 78
|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 379 | |||
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 99.76 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 99.73 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 99.73 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 99.71 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 99.69 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 99.69 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 99.68 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 99.65 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 99.65 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 99.65 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 99.63 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 99.62 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 99.62 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 99.62 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 99.61 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 99.61 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 99.61 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 99.6 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 99.6 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 99.6 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 99.59 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 99.58 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 99.58 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 99.58 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 99.57 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 99.56 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.56 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 99.55 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 99.54 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 99.54 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 99.54 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 99.54 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 99.52 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 99.51 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.51 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 99.5 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 99.47 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 99.41 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 99.37 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.37 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 99.35 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.35 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 99.26 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.17 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.1 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 99.06 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 98.85 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.83 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 98.79 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 98.24 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 98.08 | |
| 3l4c_A | 220 | Dedicator of cytokinesis protein 1; DOCK180, DOCK1 | 89.69 | |
| 2k1k_A | 38 | Ephrin type-A receptor 1; EPHA1, receptor tyrosine | 84.6 |
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
Probab=99.76 E-value=3.6e-18 Score=141.78 Aligned_cols=109 Identities=27% Similarity=0.337 Sum_probs=94.6
Q ss_pred ccccccCCcEEEEEEeecccccccccCCCCCcEEEEEEcCeeeEeeeccCCCCCCeEeeEEEEEecCCCCceEEEEEEEc
Q 016987 256 SELELKPQGKVAVTIVKANNLKNMEMIGKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVYIF 335 (379)
Q Consensus 256 ~~l~~~~~g~L~V~V~~A~~L~~~d~~g~sdPyv~v~~~~~~~~~T~v~~~tlnP~Wne~f~f~v~~~~~~~L~i~V~D~ 335 (379)
+..|..+.|.|+|+|++|++|++++..|.+||||++++++ .+++|+++++++||.|||+|.|.+.+. .+.|.++|||+
T Consensus 5 s~~~~~~~~~L~v~v~~a~~L~~~d~~g~~dpyv~v~~~~-~~~kT~~~~~t~nP~wne~f~f~~~~~-~~~l~i~V~d~ 82 (133)
T 2ep6_A 5 SSGDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGN-DRLQTHTVYKNLNPEWNKVFTFPIKDI-HDVLEVTVFDE 82 (133)
T ss_dssp CCCSCCCSEEEEEEEEEEESCCCSSSSSCCCEEEEEEETT-EEEECCCCSSCSSCCCCEEEEEEESCT-TCEEEEEEEEE
T ss_pred cccccCCceEEEEEEEeeECCCCCCCCCCcCeEEEEEECC-EEEEeeeecCCCCCccccEEEEEecCC-CCEEEEEEEEC
Confidence 3345678999999999999999999899999999999998 688999999999999999999999875 57899999999
Q ss_pred ccCCCC------------------cEEEcccCC-CCceeeEEEEEEEEEE
Q 016987 336 LLFFPA------------------QWVPILNSE-YGAALSNMHLIYIYKY 366 (379)
Q Consensus 336 d~~~~d------------------~w~~L~~~~-~g~~~g~i~l~~~~~~ 366 (379)
|.+++| .|++|.+.+ .+...|+++++++|.|
T Consensus 83 d~~~~~~~lG~~~i~l~~l~~~~~~w~~L~~~~~~~~~~G~i~l~i~~~~ 132 (133)
T 2ep6_A 83 DGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIY 132 (133)
T ss_dssp ETTEEEEECCBCEEEGGGCCSSCCEECCCBCSCTTSCCSSEEEEEEEEEE
T ss_pred CCCCCCCeeEEEEEEHHHccCCCceEEEeecCCCCCccceEEEEEEEEEe
Confidence 987543 799997554 3467899999998865
|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} | Back alignment and structure |
|---|
| >2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 379 | ||||
| d1wfja_ | 136 | b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr | 2e-12 | |
| d2bwqa1 | 125 | b.7.1.2 (A:729-853) Regulating synaptic membrane e | 2e-11 | |
| d1w15a_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi | 2e-11 | |
| d1a25a_ | 132 | b.7.1.2 (A:) C2 domain from protein kinase c (beta | 2e-11 | |
| d1uowa_ | 157 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 2e-11 | |
| d1rsya_ | 143 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 5e-11 | |
| d2cm5a1 | 137 | b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( | 2e-10 | |
| d1dqva2 | 145 | b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus | 5e-10 | |
| d1rlwa_ | 126 | b.7.1.1 (A:) Domain from cytosolic phospholipase A | 6e-10 | |
| d1rh8a_ | 142 | b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax | 1e-08 | |
| d2ep6a1 | 126 | b.7.1.1 (A:92-217) Multiple C2 and transmembrane d | 1e-08 | |
| d1qasa2 | 131 | b.7.1.1 (A:626-756) PI-specific phospholipase C is | 3e-08 | |
| d1ugka_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens | 4e-08 | |
| d1dqva1 | 130 | b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus | 9e-08 | |
| d1wfma_ | 138 | b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie | 3e-07 | |
| d2nq3a1 | 133 | b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc | 1e-06 | |
| d2cjta1 | 128 | b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no | 2e-06 | |
| d1gmia_ | 136 | b.7.1.1 (A:) Domain from protein kinase C epsilon | 3e-06 | |
| d2zkmx2 | 122 | b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human | 4e-05 |
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: Synaptotagmin-like (S variant) domain: C2 domain protein At1g63220 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 61.7 bits (149), Expect = 2e-12
Identities = 15/75 (20%), Positives = 30/75 (40%), Gaps = 1/75 (1%)
Query: 261 KPQGKVAVTIVKANNLKNMEMIGKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIA 320
P G + V +V A L++ + + DPY + + + P WN+TF
Sbjct: 7 GPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTV 66
Query: 321 EDKETQSLIFEVYIF 335
+ T+ +++
Sbjct: 67 SEGTTEL-KAKIFDK 80
|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 379 | |||
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 99.78 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 99.75 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 99.67 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 99.64 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 99.62 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 99.62 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.61 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 99.6 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.59 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 99.52 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 99.52 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 99.51 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.51 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 99.51 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.5 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 99.44 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 99.43 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.42 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 99.31 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.1 | |
| d1e7ua2 | 174 | Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) | 85.37 |
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: PLC-like (P variant) domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.78 E-value=3.7e-19 Score=144.67 Aligned_cols=104 Identities=27% Similarity=0.345 Sum_probs=90.5
Q ss_pred cCCcEEEEEEeecccccccccCCCCCcEEEEEEcCeeeEeeeccCCCCCCeEeeEEEEEecCCCCceEEEEEEEcccCCC
Q 016987 261 KPQGKVAVTIVKANNLKNMEMIGKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVYIFLLFFP 340 (379)
Q Consensus 261 ~~~g~L~V~V~~A~~L~~~d~~g~sdPyv~v~~~~~~~~~T~v~~~tlnP~Wne~f~f~v~~~~~~~L~i~V~D~d~~~~ 340 (379)
++.|.|+|+|++|++|+.++..|.+||||++++++ .+++|++++++.||.|||+|.|.+.+. .+.|.++|||+|.+++
T Consensus 3 ~~~G~L~V~v~~A~~L~~~d~~g~~Dpyv~v~~~~-~~~~T~~~~~t~nP~wne~f~f~v~~~-~~~L~i~V~d~~~~~~ 80 (126)
T d2ep6a1 3 KDVGILQVKVLKAADLLAADFSGKSDPFCLLELGN-DRLQTHTVYKNLNPEWNKVFTFPIKDI-HDVLEVTVFDEDGDKP 80 (126)
T ss_dssp CCSEEEEEEEEEEESCCCSSSSSCCCEEEEEEETT-EEEECCCCSSCSSCCCCEEEEEEESCT-TCEEEEEEEEEETTEE
T ss_pred CccEEEEEEEEEeECCCCCCCCCCcCeEEEEEcCC-eEEEEEeeCCceeEEEEEEEEEEEecc-CceeEEEEEEccCCcC
Confidence 57899999999999999999999999999999998 689999999999999999999999875 5789999999998766
Q ss_pred C------------------cEEEcccCC-CCceeeEEEEEEEEEE
Q 016987 341 A------------------QWVPILNSE-YGAALSNMHLIYIYKY 366 (379)
Q Consensus 341 d------------------~w~~L~~~~-~g~~~g~i~l~~~~~~ 366 (379)
| .|+.|.... +++..|++++++++-|
T Consensus 81 d~~lG~~~i~l~~l~~~~~~~~~l~~~~~~~~~~G~i~l~~~~i~ 125 (126)
T d2ep6a1 81 PDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIY 125 (126)
T ss_dssp EEECCBCEEEGGGCCSSCCEECCCBCSCTTSCCSSEEEEEEEEEE
T ss_pred cceEEEEEEEHHHCCCCCceEEEccccCCCCceeEEEEEEEEEEE
Confidence 4 688875432 4556799999888764
|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|