BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 017018
         (379 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1E9R|A Chain A, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Trigonal Form In Complex With Sulphate.
 pdb|1E9R|B Chain B, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Trigonal Form In Complex With Sulphate.
 pdb|1E9R|D Chain D, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Trigonal Form In Complex With Sulphate.
 pdb|1E9R|E Chain E, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Trigonal Form In Complex With Sulphate.
 pdb|1E9R|F Chain F, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Trigonal Form In Complex With Sulphate.
 pdb|1E9R|G Chain G, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Trigonal Form In Complex With Sulphate.
 pdb|1E9S|A Chain A, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|B Chain B, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|D Chain D, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|E Chain E, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|F Chain F, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|G Chain G, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|H Chain H, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|I Chain I, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|J Chain J, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|K Chain K, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|L Chain L, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1E9S|M Chain M, Bacterial Conjugative Coupling Protein Trwbdeltan70.
           Unbound Monoclinic Form.
 pdb|1GKI|A Chain A, Plasmid Coupling Protein Trwb In Complex With Adp And
           Mg2+.
 pdb|1GKI|B Chain B, Plasmid Coupling Protein Trwb In Complex With Adp And
           Mg2+.
 pdb|1GKI|D Chain D, Plasmid Coupling Protein Trwb In Complex With Adp And
           Mg2+.
 pdb|1GKI|E Chain E, Plasmid Coupling Protein Trwb In Complex With Adp And
           Mg2+.
 pdb|1GKI|F Chain F, Plasmid Coupling Protein Trwb In Complex With Adp And
           Mg2+.
 pdb|1GKI|G Chain G, Plasmid Coupling Protein Trwb In Complex With Adp And
           Mg2+.
 pdb|1GL7|A Chain A, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolisable Atp-Analogue Adpnp.
 pdb|1GL7|B Chain B, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolisable Atp-Analogue Adpnp.
 pdb|1GL7|D Chain D, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolisable Atp-Analogue Adpnp.
 pdb|1GL7|E Chain E, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolisable Atp-Analogue Adpnp.
 pdb|1GL7|F Chain F, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolisable Atp-Analogue Adpnp.
 pdb|1GL7|G Chain G, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolisable Atp-Analogue Adpnp
          Length = 437

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 139 MVKKFSEDFQIMLFHYDGQTSQW-------DEFEWSKSAIHVSIRRQT 179
           M+ KF  D  I+L  YD +T  W       ++++W + A+ V  R +T
Sbjct: 93  MLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT 140


>pdb|1GL6|A Chain A, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolysable Gtp Analogue Gdpnp
 pdb|1GL6|B Chain B, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolysable Gtp Analogue Gdpnp
 pdb|1GL6|D Chain D, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolysable Gtp Analogue Gdpnp
 pdb|1GL6|E Chain E, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolysable Gtp Analogue Gdpnp
 pdb|1GL6|F Chain F, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolysable Gtp Analogue Gdpnp
 pdb|1GL6|G Chain G, Plasmid Coupling Protein Trwb In Complex With The Non-
           Hydrolysable Gtp Analogue Gdpnp
          Length = 436

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 139 MVKKFSEDFQIMLFHYDGQTSQW-------DEFEWSKSAIHVSIRRQT 179
           M+ KF  D  I+L  YD +T  W       ++++W + A+ V  R +T
Sbjct: 92  MLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT 139


>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In
          Plant
          Length = 483

 Score = 28.1 bits (61), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 31 YFVGRSFQSVSFSKIHLPTSISTSFDIAGKEENI 64
          + +GR   S SF +I+L T+I T+ ++A K EN+
Sbjct: 9  FRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENV 42


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.136    0.437 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,648,169
Number of Sequences: 62578
Number of extensions: 556498
Number of successful extensions: 1041
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1040
Number of HSP's gapped (non-prelim): 4
length of query: 379
length of database: 14,973,337
effective HSP length: 100
effective length of query: 279
effective length of database: 8,715,537
effective search space: 2431634823
effective search space used: 2431634823
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)