Citrus Sinensis ID: 017072

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38

MGKKTSYKRLKGSQSLRQRLVLSTLASTPVLIDDIRADDTMPGLRPHEISLLRLLERICDDCVVEINETGTELEYKPGIVMGGRNLVHDCGVSRSIGYFLEPLILVGLFAKKPISIRLRGITNDPKDPSVDTFRSTTLPLLKRFGVPSEGLELKIESRGSPPDGGGEVILTIPIVDRLMAVRWLDEGMVKRIRGVSFSTRVSSQFENSMIHAARGIFNRLLPDVHIFTDHRAGPQAGKSPGYGISLVAETTSGCFISVDTAVSYARGEVDEIEYDEKRELMPPDNVGEQIASCLLEEIAKGGVVDSTHQGLLFLLCALSEPDVSKVRVGKLSPYGIEMLRNIFDFLDIRFDIMPDPSTGTVILRCVGCGYKNLSRKLS

ccccccEEEEcccHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHcccEEEEEccccEEEEEEccccccccEEEEEccccccHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccCEEEEEEcccccccccEEEEEEccccccccEEEEEccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccCEEEEEEEECccEEEEEEccccccccccccHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHcccEEEEECcccccEEEEEEEEEEccccccccc

******Y***KGSQSLRQRLVLSTLASTPVLIDDIRADDTMPGLRPHEISLLRLLERICDDCVVEINETGTELEYKPGIVMGGRNLVHDCGVSRSIGYFLEPLILVGLFAKKPISIRLRGITNDPKDPSVDTFRSTTLPLLKRFGVPSEGLELKIESRGSPPDGGGEVILTIPIVDRLMAVRWLDEGMVKRIRGVSFSTRVSSQFENSMIHAARGIFNRLLPDVHIFTDHRAGPQAGKSPGYGISLVAETTSGCFISVDTAVS********************DNVGEQIASCLLEEIAKGGVVDSTHQGLLFLLCALSEPDVSKVRVGKLSPYGIEMLRNIFDFLDIRFDIMPDPSTGTVILRCVGCGYKNLSR***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable RNA 3'-terminal phosphate cyclase-like protein	Does not have cyclase activity. Plays a role in 40S-ribosomal-subunit biogenesis in the early pre-rRNA processing steps at sites A0, A1 and A2 that are required for proper maturation of the 18S RNA.	confident	Q9C578
RNA 3'-terminal phosphate cyclase-like protein	Does not have cyclase activity. Plays a role in 40S-ribosomal-subunit biogenesis in the early pre-rRNA processing steps at sites A0, A1 and A2 that are required for proper maturation of the 18S RNA. Essential for viability.	probable	Q08096
Probable RNA 3'-terminal phosphate cyclase-like protein	Does not have cyclase activity. Plays a role in 40S-ribosomal-subunit biogenesis in the early pre-rRNA processing steps at sites A0, A1 and A2 that are required for proper maturation of the 18S RNA.	probable	Q23400

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PQV, chain A
Confidence level:very confident
Coverage over the Query: 5-265,281-370
View the alignment between query and template
View the model in PyMOL