Query         017074
Match_columns 378
No_of_seqs    193 out of 231
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 05:22:57 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/017074.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/017074hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08381 BRX:  Transcription fa 100.0 2.6E-32 5.6E-37  210.0   7.3   58  142-199     2-59  (59)
  2 PF08381 BRX:  Transcription fa 100.0 7.2E-32 1.6E-36  207.5   7.0   58  320-377     1-58  (59)
  3 PF13713 BRX_N:  Transcription   99.3 1.4E-12 2.9E-17   93.8   2.7   36   25-61      4-39  (39)
  4 PF06092 DUF943:  Enterobacteri  68.0     3.1 6.7E-05   38.3   1.7   25  178-202    51-75  (157)
  5 PF06092 DUF943:  Enterobacteri  59.8     5.3 0.00011   36.8   1.6   20  358-377    52-71  (157)
  6 PF06688 DUF1187:  Protein of u  18.0 1.7E+02  0.0037   23.7   3.4   29  156-184     3-31  (61)
  7 PF05424 Duffy_binding:  Duffy   17.6      67  0.0015   29.1   1.3   15  361-375   121-135 (182)
  8 PF05424 Duffy_binding:  Duffy   17.5      84  0.0018   28.5   1.9   18  182-199   121-138 (182)
  9 PF13119 DUF3973:  Domain of un  16.0      43 0.00093   25.1  -0.3    9    1-9       1-9   (41)
 10 PF10423 AMNp_N:  Bacterial AMP  15.7 1.2E+02  0.0026   28.2   2.4   34  150-201    63-96  (160)

No 1  
>PF08381 BRX:  Transcription factor regulating root and shoot growth via Pin3;  InterPro: IPR013591 This is a short domain, approximately 35 residues in length that is found near the C terminus in a number of plant proteins, being repeated in some members. It is found in Brevis radix-like proteins. These may act as a regulator of cell proliferation and elongation in the root []. It is also found in proteins annotated as involved in disease resistance and in the regulation of chromosome condensation, which also contain other domains with varied functions, such as TIR (IPR000157 from INTERPRO) and FYVE (IPR000306 from INTERPRO) respectively. 
Probab=99.97  E-value=2.6e-32  Score=209.97  Aligned_cols=58  Identities=72%  Similarity=1.290  Sum_probs=56.9

Q ss_pred             CCCceEEeeCCceEEEEEeCCCCCccceEEEeehhccChHHHHHHHHHhhhHHHHHhc
Q 017074          142 EPKEWVAQVEPGVLITFVSLPRGGNDLKRIRFSRDMFNKWQAQRWWAENYDRVMELYN  199 (378)
Q Consensus       142 ~~~EwieQ~EPGVyITl~~~p~G~k~LKRVRFSR~~F~e~qAq~WW~eN~~rV~e~Yn  199 (378)
                      +++|||||+||||||||+++|||+|+||||||||++|+++||+.||+||++||+++||
T Consensus         2 ~~~Ewveq~EpGVyiTl~~~p~G~~~LkRVRFSR~~F~e~qA~~WW~eN~~rv~e~Yn   59 (59)
T PF08381_consen    2 EEKEWVEQDEPGVYITLVSLPDGGNDLKRVRFSRERFSEWQAERWWEENRDRVYEKYN   59 (59)
T ss_pred             CCccEEEeeCCeeEEEEEECCCCCeeEEEEEEhhhhcCHHHHHHHHHHHHHHHHHhcC
Confidence            5789999999999999999999999999999999999999999999999999999997


No 2  
>PF08381 BRX:  Transcription factor regulating root and shoot growth via Pin3;  InterPro: IPR013591 This is a short domain, approximately 35 residues in length that is found near the C terminus in a number of plant proteins, being repeated in some members. It is found in Brevis radix-like proteins. These may act as a regulator of cell proliferation and elongation in the root []. It is also found in proteins annotated as involved in disease resistance and in the regulation of chromosome condensation, which also contain other domains with varied functions, such as TIR (IPR000157 from INTERPRO) and FYVE (IPR000306 from INTERPRO) respectively. 
Probab=99.97  E-value=7.2e-32  Score=207.49  Aligned_cols=58  Identities=64%  Similarity=1.179  Sum_probs=56.5

Q ss_pred             ccccceeeecCCceEEEEEeCCCCccceeEEeeehhccchHHHHHHHHHHHhhhhhhc
Q 017074          320 DLETEWVEQDEPGVYITIRALPGGKRELRRVRFSREKFGEMHARLWWEENRARIHEQY  377 (378)
Q Consensus       320 ~~e~EwvEQ~EPGVYITl~~~p~G~k~LKRVRFSR~~F~e~qA~~WW~eN~~RI~e~Y  377 (378)
                      ++++|||||+||||||||+++|||+++||||||||++|+++||+.||+||++||+++|
T Consensus         1 q~~~Ewveq~EpGVyiTl~~~p~G~~~LkRVRFSR~~F~e~qA~~WW~eN~~rv~e~Y   58 (59)
T PF08381_consen    1 QEEKEWVEQDEPGVYITLVSLPDGGNDLKRVRFSRERFSEWQAERWWEENRDRVYEKY   58 (59)
T ss_pred             CCCccEEEeeCCeeEEEEEECCCCCeeEEEEEEhhhhcCHHHHHHHHHHHHHHHHHhc
Confidence            4689999999999999999999999999999999999999999999999999999999


No 3  
>PF13713 BRX_N:  Transcription factor BRX N-terminal domain
Probab=99.29  E-value=1.4e-12  Score=93.83  Aligned_cols=36  Identities=56%  Similarity=0.917  Sum_probs=32.7

Q ss_pred             CCCCCchhHHHHHHHHHhhhhhhhhhcccccccCCCC
Q 017074           25 STGSGSTKQQAIKSLTSQLKDMALKASGAYRHCSPCT   61 (378)
Q Consensus        25 ~~~tp~t~~~aiKslt~QiKDmalK~SGa~r~ckp~~   61 (378)
                      ++.++.+| ++||+||+|||||++|++|+|++|+||+
T Consensus         4 aak~kaaK-e~IKsLt~QlK~maekl~~~~~~~k~~~   39 (39)
T PF13713_consen    4 AAKCKAAK-EVIKSLTAQLKDMAEKLPGAYRNCKPCS   39 (39)
T ss_pred             ccccHHHH-HHHHHHHHHHHHHHHhCchhhhccCCCC
Confidence            45567789 9999999999999999999999999995


No 4  
>PF06092 DUF943:  Enterobacterial putative membrane protein (DUF943);  InterPro: IPR010351 This family consists of several hypothetical proteins from Escherichia coli, Yersinia pestis and Salmonella typhi.
Probab=67.98  E-value=3.1  Score=38.33  Aligned_cols=25  Identities=28%  Similarity=0.622  Sum_probs=20.7

Q ss_pred             cChHHHHHHHHHhhhHHHHHhcccc
Q 017074          178 FNKWQAQRWWAENYDRVMELYNVQR  202 (378)
Q Consensus       178 F~e~qAq~WW~eN~~rV~e~Ynv~~  202 (378)
                      |++..==.||.+|+++|.++|+++.
T Consensus        51 ~Td~gKI~WW~~Nk~~l~~KY~ip~   75 (157)
T PF06092_consen   51 LTDSGKINWWLKNKDMLKEKYNIPE   75 (157)
T ss_pred             CCccchhhHHHHhHHHHHHhcCCCC
Confidence            4455666799999999999999775


No 5  
>PF06092 DUF943:  Enterobacterial putative membrane protein (DUF943);  InterPro: IPR010351 This family consists of several hypothetical proteins from Escherichia coli, Yersinia pestis and Salmonella typhi.
Probab=59.75  E-value=5.3  Score=36.84  Aligned_cols=20  Identities=25%  Similarity=0.677  Sum_probs=16.5

Q ss_pred             chHHHHHHHHHHHhhhhhhc
Q 017074          358 GEMHARLWWEENRARIHEQY  377 (378)
Q Consensus       358 ~e~qA~~WW~eN~~RI~e~Y  377 (378)
                      ++..==.||.+|+++|.++|
T Consensus        52 Td~gKI~WW~~Nk~~l~~KY   71 (157)
T PF06092_consen   52 TDSGKINWWLKNKDMLKEKY   71 (157)
T ss_pred             CccchhhHHHHhHHHHHHhc
Confidence            34555579999999999998


No 6  
>PF06688 DUF1187:  Protein of unknown function (DUF1187);  InterPro: IPR009572 This family consists of several short, hypothetical bacterial proteins of around 62 residues in length. Members of this family are found in Escherichia coli and Salmonella typhi. The function of this family is unknown.
Probab=18.05  E-value=1.7e+02  Score=23.65  Aligned_cols=29  Identities=21%  Similarity=0.315  Sum_probs=24.2

Q ss_pred             EEEEeCCCCCccceEEEeehhccChHHHH
Q 017074          156 ITFVSLPRGGNDLKRIRFSRDMFNKWQAQ  184 (378)
Q Consensus       156 ITl~~~p~G~k~LKRVRFSR~~F~e~qAq  184 (378)
                      ||-.+..-|+--.+++|||...-++.+-+
T Consensus         3 ItAtI~KpG~~Pv~W~rys~~kmT~~eCe   31 (61)
T PF06688_consen    3 ITATIIKPGNTPVNWTRYSDSKMTKAECE   31 (61)
T ss_pred             eEEEEEcCCCCCeeeEEecCCccCHHHHH
Confidence            78888999999999999998877765543


No 7  
>PF05424 Duffy_binding:  Duffy binding domain;  InterPro: IPR008602 This family contains several Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade Homo sapiens erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localised in micronemes, an organelle found in all organisms of the phylum Apicomplexa [].; GO: 0004872 receptor activity, 0009405 pathogenesis, 0016021 integral to membrane; PDB: 2WAU_B 3CML_A 3CPZ_A 3BQL_A 3BQK_A 3BQI_A 3RRC_B 2XU0_A 2YK0_A 2C6J_A ....
Probab=17.58  E-value=67  Score=29.10  Aligned_cols=15  Identities=47%  Similarity=0.946  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHhhhhh
Q 017074          361 HARLWWEENRARIHE  375 (378)
Q Consensus       361 qA~~WW~eN~~RI~e  375 (378)
                      .-+.||++|+..|=+
T Consensus       121 ~Re~WW~~nr~~IWk  135 (182)
T PF05424_consen  121 LREDWWEENRKHIWK  135 (182)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhHHHhhc
Confidence            458899999988754


No 8  
>PF05424 Duffy_binding:  Duffy binding domain;  InterPro: IPR008602 This family contains several Plasmodium Duffy binding proteins. Plasmodium vivax and Plasmodium knowlesi merozoites invade Homo sapiens erythrocytes that express Duffy blood group surface determinants. The Duffy receptor family is localised in micronemes, an organelle found in all organisms of the phylum Apicomplexa [].; GO: 0004872 receptor activity, 0009405 pathogenesis, 0016021 integral to membrane; PDB: 2WAU_B 3CML_A 3CPZ_A 3BQL_A 3BQK_A 3BQI_A 3RRC_B 2XU0_A 2YK0_A 2C6J_A ....
Probab=17.48  E-value=84  Score=28.49  Aligned_cols=18  Identities=22%  Similarity=0.619  Sum_probs=14.1

Q ss_pred             HHHHHHHHhhhHHHHHhc
Q 017074          182 QAQRWWAENYDRVMELYN  199 (378)
Q Consensus       182 qAq~WW~eN~~rV~e~Yn  199 (378)
                      .-+.||++|+..|-+---
T Consensus       121 ~Re~WW~~nr~~IWkaM~  138 (182)
T PF05424_consen  121 LREDWWEENRKHIWKAMI  138 (182)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhHHHhhccee
Confidence            458999999998866544


No 9  
>PF13119 DUF3973:  Domain of unknown function (DUF3973)
Probab=16.00  E-value=43  Score=25.05  Aligned_cols=9  Identities=44%  Similarity=0.696  Sum_probs=5.7

Q ss_pred             CcccccccC
Q 017074            1 MLTCIARSK    9 (378)
Q Consensus         1 MltCIacsk    9 (378)
                      |.-||.||+
T Consensus         1 MyYCi~Cs~    9 (41)
T PF13119_consen    1 MYYCINCSE    9 (41)
T ss_pred             CEEEEEhHH
Confidence            566666665


No 10 
>PF10423 AMNp_N:  Bacterial AMP nucleoside phosphorylase N-terminus ;  InterPro: IPR018953  This is the N-terminal domain of bacterial AMP nucleoside phosphorylase (AMNp). The N- and C-termini form distinct domains which intertwine with each other to form a stable monomer which associates with five other monomers to yield the active hexamer. The N terminus consists of a long helix and a four-stranded sheet with a novel topology. The C terminus binds the nucleoside whereas the N terminus acts as the enzymatic regulatory domain. AMNp (3.2.2.4 from EC) catalyses the hydrolysis of AMP to form adenine and ribose 5-phosphate. thereby regulating intracellular AMP levels []. ; PDB: 1T8R_B 1T8Y_E 1T8W_A 1T8S_F 2GUW_A.
Probab=15.71  E-value=1.2e+02  Score=28.17  Aligned_cols=34  Identities=32%  Similarity=0.557  Sum_probs=24.5

Q ss_pred             eCCceEEEEEeCCCCCccceEEEeehhccChHHHHHHHHHhhhHHHHHhccc
Q 017074          150 VEPGVLITFVSLPRGGNDLKRIRFSRDMFNKWQAQRWWAENYDRVMELYNVQ  201 (378)
Q Consensus       150 ~EPGVyITl~~~p~G~k~LKRVRFSR~~F~e~qAq~WW~eN~~rV~e~Ynv~  201 (378)
                      .+||+|.|-++.|+             .|.     ..+.|-...|++.|+|.
T Consensus        63 ~~pG~Y~tTvTRP~-------------LFr-----~YL~eQl~lL~~ny~v~   96 (160)
T PF10423_consen   63 SEPGVYSTTVTRPD-------------LFR-----DYLREQLTLLLRNYGVP   96 (160)
T ss_dssp             SSSEEEEEE---TT-------------TTH-----HHHHHHHHHHHHCC--E
T ss_pred             CCCceeEEeCcCHH-------------HHH-----HHHHHHHHHHHHcCCCc
Confidence            47999999999984             554     48999999999999974


Done!