Query         017076
Match_columns 378
No_of_seqs    110 out of 142
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 05:24:00 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/017076.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/017076hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11891 DUF3411:  Domain of un 100.0 1.9E-75 4.1E-80  532.0  15.0  178  151-328     1-179 (180)
  2 COG4907 Predicted membrane pro  88.8    0.25 5.4E-06   52.4   2.1   10   28-37    551-560 (595)
  3 PF02957 TT_ORF2:  TT viral ORF  69.2      14 0.00031   31.7   5.9   13   91-103   106-118 (122)
  4 PF02979 NHase_alpha:  Nitrile   60.1     5.6 0.00012   37.8   1.9   43  117-161    16-68  (188)
  5 PLN03138 Protein TOC75; Provis  54.9      20 0.00044   40.6   5.3    7  300-306   326-332 (796)
  6 KOG3074 Transcriptional regula  47.8      11 0.00024   37.2   1.8   13  131-143    38-50  (263)
  7 PF07631 PSD4:  Protein of unkn  40.4      54  0.0012   28.9   4.8   33  109-159    17-51  (128)
  8 COG1512 Beta-propeller domains  39.9      28 0.00062   34.6   3.2    7   66-72    239-245 (271)
  9 KOG3973 Uncharacterized conser  36.1      27 0.00058   36.6   2.5   22   65-86    360-383 (465)
 10 PF08671 SinI:  Anti-repressor   31.8      45 0.00098   23.0   2.3   21  114-135     9-29  (30)
 11 KOG4096 Uncharacterized conser  31.3     7.9 0.00017   31.9  -1.7   20  303-322    52-71  (75)
 12 PRK05325 hypothetical protein;  30.1      56  0.0012   34.4   3.7   12   92-103   103-114 (401)
 13 PLN02705 beta-amylase           28.3 1.1E+02  0.0023   34.4   5.5   13  248-260   303-315 (681)
 14 PHA00370 III attachment protei  27.9      54  0.0012   33.0   3.0    7  234-240   244-250 (297)
 15 PF07096 DUF1358:  Protein of u  27.7      84  0.0018   28.3   3.9   53  261-316    30-91  (124)
 16 PTZ00146 fibrillarin; Provisio  26.8      61  0.0013   32.7   3.2    6  259-264   227-232 (293)
 17 TIGR01323 nitrile_alph nitrile  26.7      47   0.001   31.6   2.2   42  117-160    10-61  (185)
 18 TIGR02877 spore_yhbH sporulati  23.2      68  0.0015   33.5   2.8   11   92-102   115-125 (371)
 19 PLN02705 beta-amylase           22.7 1.1E+02  0.0025   34.1   4.5    9  279-287   270-278 (681)
 20 KOG0921 Dosage compensation co  22.7      68  0.0015   37.6   2.9   27   66-92   1252-1278(1282)
 21 KOG1456 Heterogeneous nuclear   22.0      77  0.0017   33.7   2.9   11  112-122    46-56  (494)
 22 COG0536 Obg Predicted GTPase [  20.4      78  0.0017   33.1   2.5   12   61-72      9-20  (369)
 23 KOG0624 dsRNA-activated protei  20.2      55  0.0012   34.7   1.4   14   59-72    464-477 (504)

No 1  
>PF11891 DUF3411:  Domain of unknown function (DUF3411);  InterPro: IPR021825  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 168 to 186 amino acids in length. This domain has a conserved RYQ sequence motif. 
Probab=100.00  E-value=1.9e-75  Score=532.02  Aligned_cols=178  Identities=53%  Similarity=0.801  Sum_probs=174.3

Q ss_pred             hhhccChhhHHHHHHHhhhhhhhhHHHHHhhcccchHhHHHHHHHHHHHHHHHHHHhhhhcccccccCCCcccccC-hhh
Q 017076          151 ERLLADDLFLAKVAMECGVGVFTKTAAELERRRENFSKELDFVFADVVMAIIADFMLVWLPAPTISLRPPLAMSTG-PIA  229 (378)
Q Consensus       151 ~RlLADP~FlfKl~~E~~i~v~~~~~aE~~~Rge~F~~ElDfv~sd~v~g~i~nf~LV~LlAPt~s~~~~~~~~ag-~l~  229 (378)
                      |||||||+|||||++||+||++|+++|||++|||+||+|||||+||+++++|+||+||||||||++++++.+...| .++
T Consensus         1 ~RllADP~Fl~Kl~~E~~i~i~~~~~~e~~~R~e~f~~E~d~v~~d~v~~~i~n~~lv~llAPt~s~~~~~~~~~~~~~~   80 (180)
T PF11891_consen    1 ERLLADPSFLFKLAIEEVIGIGCATAAEYAKRGERFWNELDFVFSDVVVGSIVNFALVWLLAPTRSFGSPAASSPGGGLQ   80 (180)
T ss_pred             CcccccchHHHHHHHHHHHHHHHHHHHHHHHcccchHHHHHHHHHHHHHHHHHHHHHHHhccchHhhCcccccccchHHH
Confidence            7999999999999999999999999999999999999999999999999999999999999999999998775544 999


Q ss_pred             hhhhcCCchhhhcccCCCCcchhhhHHHHhhcchhhhhhhhhhhhhHHHHHHHHHHHHhhcCCCCCCCCCCCcchhhhhh
Q 017076          230 KFFFNCPDNAFQVAFTGTSYSLIQRIGAIVRNGAKLFAVGTSASLVGVGITNALINARKALDTSFAGEAEDVPIISTSVA  309 (378)
Q Consensus       230 k~~~~lP~n~Fq~~~pg~~fsl~qR~~a~~~KG~~l~~VG~~aglvG~glsN~L~~~Rk~~d~~~~~~~~~pP~l~tal~  309 (378)
                      |++++||+|+||+++||++||++||++||+|||++|++|||+||++|+++||+|+++||++||+||+++++||+++||++
T Consensus        81 ~~~~~~P~n~Fq~~~~g~~fsl~qR~~~~~~kg~~l~~VG~~ag~vg~~lsn~L~~~rk~~~~~~e~~~~~ppv~~ta~~  160 (180)
T PF11891_consen   81 KFLGSLPNNAFQKGYPGRSFSLAQRIGAFVYKGAKLAAVGFIAGLVGTGLSNALIAARKKVDPSFEPSVPVPPVLKTALG  160 (180)
T ss_pred             HHHHhChHHHhccCCCCCcccHHHHHHHHHHcchHhhhhHHHHHHHHHHHHHHHHHHHHhcCccccCCCCCCCHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHhhhhccchhhHHHHHHH
Q 017076          310 YGVYMAVSSNLRYQVLAGV  328 (378)
Q Consensus       310 wg~fMGvSSNlRYQil~Gl  328 (378)
                      ||+|||+|||+|||+|||+
T Consensus       161 ~g~fmGvSsNlRYQil~Gi  179 (180)
T PF11891_consen  161 WGAFMGVSSNLRYQILNGI  179 (180)
T ss_pred             HHHHHhhhHhHHHHHHcCC
Confidence            9999999999999999998


No 2  
>COG4907 Predicted membrane protein [Function unknown]
Probab=88.82  E-value=0.25  Score=52.44  Aligned_cols=10  Identities=30%  Similarity=0.398  Sum_probs=4.4

Q ss_pred             eccccCCCCC
Q 017076           28 KNITRQIPNP   37 (378)
Q Consensus        28 ~~~~~~~~~~   37 (378)
                      ||-+|--.++
T Consensus       551 ~nysr~~~~~  560 (595)
T COG4907         551 NNYSRSFNNL  560 (595)
T ss_pred             cchhhhhccc
Confidence            4444444333


No 3  
>PF02957 TT_ORF2:  TT viral ORF2;  InterPro: IPR004118 This entry represents the Gyroviral VP2 protein and TT viral ORF2.  Torque teno virus (TTV) is a nonenveloped and single-stranded DNA virus that was initially isolated from a Japanese patient with hepatitis of unknown aetiology, and which has since been found to infect both healthy and diseased individuals []. Numerous prevalence studies have raised questions about its role in unexplained hepatitis. ORF2 is a 150 residue protein of unknown function.  Gyroviruses are small circular single stranded viruses, such as the Chicken anaemia virus. The VP2 protein contains a set of conserved cysteine and histidine residues suggesting a zinc binding domain. VP2 may act as a scaffold protein in virion assembly and may also play a role in intracellular signaling during viral replication.
Probab=69.15  E-value=14  Score=31.74  Aligned_cols=13  Identities=15%  Similarity=-0.102  Sum_probs=6.6

Q ss_pred             CChHHHHHHHHHh
Q 017076           91 HNCTEAIFALAKA  103 (378)
Q Consensus        91 ~~r~e~~~Vl~e~  103 (378)
                      -.-+++++++++.
T Consensus       106 ~~~~dld~L~aa~  118 (122)
T PF02957_consen  106 YDEEDLDELFAAA  118 (122)
T ss_pred             CChHHHHHHhhhh
Confidence            3445555555543


No 4  
>PF02979 NHase_alpha:  Nitrile hydratase, alpha chain;  InterPro: IPR004232 Nitrile hydratases (4.2.1.84 from EC) are bacterial enzymes that catalyse the hydration of nitrile compounds to the corresponding amides. They are used as biocatalysts in acrylamide production, one of the few commercial scale bioprocesses, as well as in environmental remediation for the removal of nitriles from waste streams. Nitrile hydratases are composed of two subunits, alpha and beta, and are normally active as a tetramer, alpha(2)beta(2). Nitrile hydratases contain either a non-haem iron or a non-corrinoid cobalt centre, both types sharing a highly conserved peptide sequence in the alpha subunit (CXLCSC) that provides all the residues involved in coordinating the metal ion. Each type of nitrile hydratase specifically incorporated its metal with the help of activator proteins encoded by flanking regions of the nitrile hydratase genes that are necessary for metal insertion. The Fe-containing enzyme is photo-regulated: in the dark the enzyme is inactivated due to the association of nitric oxide (NO) to the iron, while in the light the enzyme is active by photo-dissociation of NO. The NO is held in place by a claw setting formed through specific oxygen atoms in two modified cysteines and a serine residue in the active site [, ]. The cobalt-containing enzyme is unaffected by NO, but was shown to undergo a similar effect with carbon monoxide [, ]. Fe- and cobalt-containing enzymes also display different inhibition patterns with nitrophenols. Thiocyanate hydrolase (SCNase) is a cobalt-containing metalloenzyme with a cysteine-sulphinic acid ligand that hydrolyses thiocyanate to carbonyl sulphide and ammonia []. The two enzymes, nitrile hydratase and SCNase, are homologous over regions corresponding to almost the entire coding regions of the genes: the beta and alpha subunits of thiocyanate hydrolase were homologous to the amino- and carboxyl-terminal halves of the beta subunit of nitrile hydratase, and the gamma subunit of thiocyanate hydrolase was homologous to the alpha subunit of nitrile hydratase [].  This entry represents the structural domain of the alpha subunit of both iron- and cobalt-containing nitrile hydratases; the alpha subunit is a duplication of two structural repeats, each consisting of 4 layers, alpha/beta/beta/alpha []. This structure is also found in the related protein, the gamma subunit of thiocyanate hydrolase (SCNase).; GO: 0003824 catalytic activity, 0046914 transition metal ion binding, 0006807 nitrogen compound metabolic process; PDB: 2DPP_A 3HHT_A 1V29_A 2ZZD_I 2DXC_F 2DXB_F 2DD5_C 2DD4_C 2ZPH_A 2CYZ_A ....
Probab=60.07  E-value=5.6  Score=37.78  Aligned_cols=43  Identities=37%  Similarity=0.464  Sum_probs=31.0

Q ss_pred             HHHcCCCCHHHHHHHHhhccC---chh-------hhhhhcccchhhhccChhhHH
Q 017076          117 AIEAGRVPAAIVKRYLELEKS---PVF-------RWLLNFGGFRERLLADDLFLA  161 (378)
Q Consensus       117 A~e~G~vs~~~L~rfl~l~~~---p~~-------~~l~~~~g~R~RlLADP~Flf  161 (378)
                      -+|.|.|+++.+.++.+...+   |-.       +|.  -++||+|||+||.=..
T Consensus        16 l~ekg~~~~~~~~~~~~~~~~~~~P~~GarvVArAW~--Dp~FK~rLLaD~~aA~   68 (188)
T PF02979_consen   16 LIEKGLITPAEVDRIIETYESRVGPRNGARVVARAWT--DPAFKARLLADPTAAI   68 (188)
T ss_dssp             HHHTTSS-HHHHHHHHHHHHHTSSHHHHHHHHHHHHH---HHHHHHHHHSHHHHH
T ss_pred             HHHcCCCCHHHHHHHHHHHHhccCccccceeehhhhC--CHHHHHHHHHCHHHHH
Confidence            368899999999998887654   421       244  4999999999997444


No 5  
>PLN03138 Protein TOC75; Provisional
Probab=54.88  E-value=20  Score=40.63  Aligned_cols=7  Identities=14%  Similarity=0.197  Sum_probs=2.7

Q ss_pred             CCcchhh
Q 017076          300 DVPIIST  306 (378)
Q Consensus       300 ~pP~l~t  306 (378)
                      +++.+..
T Consensus       326 ~~~~id~  332 (796)
T PLN03138        326 NFGNLNT  332 (796)
T ss_pred             cccccCC
Confidence            3334433


No 6  
>KOG3074 consensus Transcriptional regulator of the PUR family, single-stranded-DNA-binding [Transcription]
Probab=47.83  E-value=11  Score=37.20  Aligned_cols=13  Identities=38%  Similarity=0.835  Sum_probs=7.0

Q ss_pred             HHhhccCchhhhh
Q 017076          131 YLELEKSPVFRWL  143 (378)
Q Consensus       131 fl~l~~~p~~~~l  143 (378)
                      |||+...|-.|+|
T Consensus        38 YlDvkqN~rGRfl   50 (263)
T KOG3074|consen   38 YLDVKQNPRGRFL   50 (263)
T ss_pred             EEEeccCCCcceE
Confidence            5666666544444


No 7  
>PF07631 PSD4:  Protein of unknown function (DUF1592);  InterPro: IPR013042  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013039 from INTERPRO and IPR013043 from INTERPRO.
Probab=40.44  E-value=54  Score=28.90  Aligned_cols=33  Identities=30%  Similarity=0.405  Sum_probs=24.1

Q ss_pred             Cch-HHHHHHHHcCCC-CHHHHHHHHhhccCchhhhhhhcccchhhhccChhh
Q 017076          109 DLP-KDLAGAIEAGRV-PAAIVKRYLELEKSPVFRWLLNFGGFRERLLADDLF  159 (378)
Q Consensus       109 ~LP-~dl~~A~e~G~v-s~~~L~rfl~l~~~p~~~~l~~~~g~R~RlLADP~F  159 (378)
                      +.| +.|.+|++.|.+ +++++.+                  -.+|||+||.+
T Consensus        17 s~PD~~L~~aA~~g~L~~~~~l~~------------------q~~RML~dpr~   51 (128)
T PF07631_consen   17 SPPDAELLDAAAAGELRTPEQLRA------------------QAERMLADPRA   51 (128)
T ss_pred             CCCCHHHHHHHHhCCCCCHHHHHH------------------HHHHHHcCccH
Confidence            456 678899999987 4455443                  35799999987


No 8  
>COG1512 Beta-propeller domains of methanol dehydrogenase type [General function prediction only]
Probab=39.85  E-value=28  Score=34.63  Aligned_cols=7  Identities=57%  Similarity=1.242  Sum_probs=2.8

Q ss_pred             cCCCCCC
Q 017076           66 GGGKGGG   72 (378)
Q Consensus        66 ~~gg~~~   72 (378)
                      |+|++|+
T Consensus       239 g~g~~g~  245 (271)
T COG1512         239 GSGGSGG  245 (271)
T ss_pred             CCCCCCC
Confidence            3444433


No 9  
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=36.10  E-value=27  Score=36.56  Aligned_cols=22  Identities=50%  Similarity=1.004  Sum_probs=0.0

Q ss_pred             ccCCC--CCCCCCCCCCCCCCCCC
Q 017076           65 SGGGK--GGGGSWGSGGGGGGGDD   86 (378)
Q Consensus        65 ~~~gg--~~~~~~~~gg~g~g~~~   86 (378)
                      .|+||  +|-|||-||||+|||++
T Consensus       360 gg~Gg~~gGrGgGRGggG~GGGgg  383 (465)
T KOG3973|consen  360 GGSGGNWGGRGGGRGGGGRGGGGG  383 (465)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCC


No 10 
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=31.81  E-value=45  Score=22.99  Aligned_cols=21  Identities=19%  Similarity=0.422  Sum_probs=14.7

Q ss_pred             HHHHHHcCCCCHHHHHHHHhhc
Q 017076          114 LAGAIEAGRVPAAIVKRYLELE  135 (378)
Q Consensus       114 l~~A~e~G~vs~~~L~rfl~l~  135 (378)
                      |.+|.++ +++.++..+||+.+
T Consensus         9 i~eA~~~-Gls~eeir~FL~~~   29 (30)
T PF08671_consen    9 IKEAKES-GLSKEEIREFLEFN   29 (30)
T ss_dssp             HHHHHHT-T--HHHHHHHHHHH
T ss_pred             HHHHHHc-CCCHHHHHHHHHhC
Confidence            5667665 58999999999875


No 11 
>KOG4096 consensus Uncharacterized conserved protein [Function unknown]
Probab=31.31  E-value=7.9  Score=31.86  Aligned_cols=20  Identities=20%  Similarity=0.698  Sum_probs=17.3

Q ss_pred             chhhhhhhHhhhhccchhhH
Q 017076          303 IISTSVAYGVYMAVSSNLRY  322 (378)
Q Consensus       303 ~l~tal~wg~fMGvSSNlRY  322 (378)
                      +++++.++|+||++-+-+||
T Consensus        52 ~~~SagtFG~FM~igs~Ir~   71 (75)
T KOG4096|consen   52 MLQSAGTFGLFMGIGSGIRC   71 (75)
T ss_pred             HHhccchhhhhhhhhhheec
Confidence            56777899999999998887


No 12 
>PRK05325 hypothetical protein; Provisional
Probab=30.14  E-value=56  Score=34.38  Aligned_cols=12  Identities=17%  Similarity=0.041  Sum_probs=6.8

Q ss_pred             ChHHHHHHHHHh
Q 017076           92 NCTEAIFALAKA  103 (378)
Q Consensus        92 ~r~e~~~Vl~e~  103 (378)
                      .++|...+|=|-
T Consensus       103 s~eE~~~~lfEd  114 (401)
T PRK05325        103 SLEELLDLLFED  114 (401)
T ss_pred             cHHHHHHHHHhh
Confidence            456666665543


No 13 
>PLN02705 beta-amylase
Probab=28.31  E-value=1.1e+02  Score=34.35  Aligned_cols=13  Identities=23%  Similarity=0.289  Sum_probs=6.4

Q ss_pred             CcchhhhHHHHhh
Q 017076          248 SYSLIQRIGAIVR  260 (378)
Q Consensus       248 ~fsl~qR~~a~~~  260 (378)
                      +|+--+++..++.
T Consensus       303 dWsgY~~L~~mvr  315 (681)
T PLN02705        303 VWSGYRELFNIIR  315 (681)
T ss_pred             CcHHHHHHHHHHH
Confidence            4444455555444


No 14 
>PHA00370 III attachment protein
Probab=27.91  E-value=54  Score=32.98  Aligned_cols=7  Identities=29%  Similarity=0.729  Sum_probs=3.2

Q ss_pred             cCCchhh
Q 017076          234 NCPDNAF  240 (378)
Q Consensus       234 ~lP~n~F  240 (378)
                      .||+-+|
T Consensus       244 ~C~~FV~  250 (297)
T PHA00370        244 GCTPFVF  250 (297)
T ss_pred             CCCccee
Confidence            4444443


No 15 
>PF07096 DUF1358:  Protein of unknown function (DUF1358);  InterPro: IPR009792 This family consists of several hypothetical eukaryotic proteins of around 125 residues in length. The function of this family is unknown.
Probab=27.73  E-value=84  Score=28.25  Aligned_cols=53  Identities=23%  Similarity=0.308  Sum_probs=29.4

Q ss_pred             cchhhhhhhhhhhhhHHHHHHHHHHHHhhcCCCCCCCC-CC------Ccc--hhhhhhhHhhhhc
Q 017076          261 NGAKLFAVGTSASLVGVGITNALINARKALDTSFAGEA-ED------VPI--ISTSVAYGVYMAV  316 (378)
Q Consensus       261 KG~~l~~VG~~aglvG~glsN~L~~~Rk~~d~~~~~~~-~~------pP~--l~tal~wg~fMGv  316 (378)
                      .++.++.|+.++-++|-  +..|..+||+ ||.+-... ..      .+.  -..||+||..+.+
T Consensus        30 ~~~FL~~Va~~s~~aGF--~~tl~~aKKk-~p~~F~kg~~~~~~l~esGasLAlRALgWGTlyA~   91 (124)
T PF07096_consen   30 GGAFLGGVAGASALAGF--GTTLALAKKK-SPKWFSKGISQTKALHESGASLALRALGWGTLYAV   91 (124)
T ss_pred             HHHHHHHHHHHHHHHHH--HHHHHHHHhc-CcHHHhccCcCcccCCcchHHHHHHHHhHHHHHHH
Confidence            34455567666665554  5556666777 55442222 11      111  3457899977665


No 16 
>PTZ00146 fibrillarin; Provisional
Probab=26.82  E-value=61  Score=32.66  Aligned_cols=6  Identities=33%  Similarity=0.889  Sum_probs=2.2

Q ss_pred             hhcchh
Q 017076          259 VRNGAK  264 (378)
Q Consensus       259 ~~KG~~  264 (378)
                      +.+|..
T Consensus       227 LKpGG~  232 (293)
T PTZ00146        227 LKNGGH  232 (293)
T ss_pred             ccCCCE
Confidence            333333


No 17 
>TIGR01323 nitrile_alph nitrile hydratase, alpha subunit. This model describes both iron- and cobalt-containing nitrile hydratase alpha chains. It excludes the thiocyanate hydrolase gamma subunit of Thiobacillus thioparus, a sequence that appears to have evolved from within the family of nitrile hydratase alpha subunits but which differs by several indels and a more rapid accumulation of point mutations.
Probab=26.68  E-value=47  Score=31.65  Aligned_cols=42  Identities=26%  Similarity=0.373  Sum_probs=30.8

Q ss_pred             HHHcCCCCHHHHHHHHhhccC---chh-------hhhhhcccchhhhccChhhH
Q 017076          117 AIEAGRVPAAIVKRYLELEKS---PVF-------RWLLNFGGFRERLLADDLFL  160 (378)
Q Consensus       117 A~e~G~vs~~~L~rfl~l~~~---p~~-------~~l~~~~g~R~RlLADP~Fl  160 (378)
                      -+|.|.|+++.+.+.++....   |..       +|.  -|.||.|||+|..=.
T Consensus        10 l~eKGli~~~~id~~i~~~~~~~gP~nGA~vVArAW~--Dp~fk~~Ll~d~~aa   61 (185)
T TIGR01323        10 LKSKGLIPEGAVDQLTSLYENEWGPENGAKVVAKAWV--DPEFRALLLKDATAA   61 (185)
T ss_pred             HHHcCCCCHHHHHHHHHHHHhccCCcchhhhhhHHhc--CHHHHHHHHhChHHH
Confidence            357899999999888876544   421       143  489999999998643


No 18 
>TIGR02877 spore_yhbH sporulation protein YhbH. This protein family, typified by YhbH in Bacillus subtilis, is found in nearly every endospore-forming bacterium and in no other genome (but note that the trusted cutoff score is set high to exclude a single high-scoring sequence from Nitrosococcus oceani ATCC 19707, which is classified in the Gammaproteobacteria). The gene in Bacillus subtilis was shown to be in the regulon of the sporulation sigma factor, sigma-E, and its mutation was shown to create a sporulation defect.
Probab=23.18  E-value=68  Score=33.54  Aligned_cols=11  Identities=18%  Similarity=0.005  Sum_probs=5.9

Q ss_pred             ChHHHHHHHHH
Q 017076           92 NCTEAIFALAK  102 (378)
Q Consensus        92 ~r~e~~~Vl~e  102 (378)
                      .++|...+|=|
T Consensus       115 s~eE~~~~lfE  125 (371)
T TIGR02877       115 TLEELFELLFE  125 (371)
T ss_pred             cHHHHHHHHHh
Confidence            35566555544


No 19 
>PLN02705 beta-amylase
Probab=22.70  E-value=1.1e+02  Score=34.13  Aligned_cols=9  Identities=11%  Similarity=0.335  Sum_probs=3.6

Q ss_pred             HHHHHHHHH
Q 017076          279 ITNALINAR  287 (378)
Q Consensus       279 lsN~L~~~R  287 (378)
                      +.+.|.++|
T Consensus       270 l~a~L~aLK  278 (681)
T PLN02705        270 VRQELSHMK  278 (681)
T ss_pred             HHHHHHHHH
Confidence            334444433


No 20 
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=22.66  E-value=68  Score=37.63  Aligned_cols=27  Identities=37%  Similarity=0.502  Sum_probs=0.0

Q ss_pred             cCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 017076           66 GGGKGGGGSWGSGGGGGGGDDDAGFHN   92 (378)
Q Consensus        66 ~~gg~~~~~~~~gg~g~g~~~~~~~~~   92 (378)
                      |+||.+.++|.++|||||=++.++.-+
T Consensus      1252 gsGGfgrgggrgagggGgfg~G~~Gg~ 1278 (1282)
T KOG0921|consen 1252 GSGGFGRGGGRGAGGGGGFGGGGRGGN 1278 (1282)
T ss_pred             CCCCcCCCCCCCCCCCCCCCCCCcccc


No 21 
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]
Probab=21.97  E-value=77  Score=33.65  Aligned_cols=11  Identities=27%  Similarity=0.199  Sum_probs=5.7

Q ss_pred             HHHHHHHHcCC
Q 017076          112 KDLAGAIEAGR  122 (378)
Q Consensus       112 ~dl~~A~e~G~  122 (378)
                      +|+.+|++.++
T Consensus        46 adl~eal~~fG   56 (494)
T KOG1456|consen   46 ADLVEALSNFG   56 (494)
T ss_pred             hHHHHHHhcCC
Confidence            45555555443


No 22 
>COG0536 Obg Predicted GTPase [General function prediction only]
Probab=20.36  E-value=78  Score=33.11  Aligned_cols=12  Identities=25%  Similarity=0.512  Sum_probs=7.3

Q ss_pred             eeEeccCCCCCC
Q 017076           61 VIFASGGGKGGG   72 (378)
Q Consensus        61 ~~~~~~~gg~~~   72 (378)
                      ..+..|+||+|-
T Consensus         9 I~v~aG~GGnG~   20 (369)
T COG0536           9 IEVKAGDGGNGC   20 (369)
T ss_pred             EEEEecCCCCee
Confidence            345567777664


No 23 
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]
Probab=20.25  E-value=55  Score=34.70  Aligned_cols=14  Identities=36%  Similarity=0.456  Sum_probs=9.6

Q ss_pred             CceeEeccCCCCCC
Q 017076           59 PTVIFASGGGKGGG   72 (378)
Q Consensus        59 ~~~~~~~~~gg~~~   72 (378)
                      .|+....+-|||||
T Consensus       464 DPLD~Es~q~GGGg  477 (504)
T KOG0624|consen  464 DPLDPESQQGGGGG  477 (504)
T ss_pred             CCCChhhccCCCCC
Confidence            57777777666655


Done!