Citrus Sinensis ID: 017092

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------

MEAMDAPISNFTAVHAGNPESDVAEVESFTLRVDDIFQKVDKLEERVNEIEQFYLNASKKQGSNSKGSSTLKDKEKERHVPSIRKQQQEASRREKAAEKRMEELIRQFGTILRNITQHKWAWPFMQPVDVKGLGLDDYYEVIDKPMDFSTIKKQMEAKEYKNVREICTDVRLVFKNAMKYNDERSDVHVMAKTLLAKFEEKWLQLLPKVTEEEKRREEEEAEAQLDMQLAQDAAHAKMARDTSNELYEVDVHLDELREMLVQKCRKTSTEEKRKLGAALTRLSPEDLGKALEIVAQSNTGFQATAEEVELDMDAQSESTLWRLKFFVKDALKSQGNNNNNDNNKNNNNSATNNNKRKREICDAIAKTAKKKKQKASA

cccccccccccccccccccccccHHHHHHcccHHHHHccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHcHHHHHHHHHHccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccc

************************EVESFT*R**DIF*K****************************************************************LIRQFGTILRNITQHKWAWPFMQPVDVKGLGLDDYYEVIDKPMDFSTIKKQMEAKEYKNVREICTDVRLVFKNAMKYNDERSDVHVMAKTLLAKFEEKWLQLLPKVT****************************************************************************LGKALEIV**************ELDMDAQSESTLWRLKFFVK*************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEAMDAPISNFTAVHAGNPESDVAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQGSNSKGSSTLKDKEKERHVPSIRKQxxxxxxxxxxxxxxxxxxxxxFGTILRNITQHKWAWPFMQPVDVKGLGLDDYYEVIDKPMDFSTIKKQMEAKEYKNVREICTDVRLVFKNAMKYNDERSDVHVMAKTLLAKFEEKWLQLLPKVTxxxxxxxxxxxxxxxxxxxxxDAAHAKMARDTSNELYEVDVHLDELREMLVQKCRKTSTEEKRKLGAALTRLSPEDLGKALEIVAQSNTGFQATAEEVELDMDAQSESTLWRLKFFVKDALKSQGNNNNNDNNKNNNNSATNNNKRKREICDAIAKTAKKKKQKASA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor GTE1	Transcription activator that plays a role in the promotion of seed germination by both negatively and positively regulating the abscisic acid (ABA) and phytochrome A (phyA) transduction pathways, respectively.	probable	Q84XV2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OUO, chain A
Confidence level:very confident
Coverage over the Query: 100-207
View the alignment between query and template
View the model in PyMOL

Template: 2JNS, chain A
Confidence level:very confident
Coverage over the Query: 262-335
View the alignment between query and template
View the model in PyMOL