Citrus Sinensis ID: 017095


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------
MEDNEVETSEWVGSPGLTNISNGPFHTPVSAKGGRVNNRSKGIKGNRSTPQTPVSNAGSPSALTPAGSCRYDSSLGLLTKKFINLIKHAEDGILDLNKAAETLEVQKRRIYDITNVLEGIGLIEKKLKNRIRWKGLDNSIPGEVDADASILQADIDNLSMEELRVDEQTRELRERLRELIENENNRKWLFVTEEDIKNLHCFQNQTLIAIKAPQGTTLEVPDPDEAVDYPQRRYRIILRSTMGPIDVYLVSRFEEKFEETNSVEPPASVPPVSSSDSNENQVKEIINVDRAGNETEAQAQQAHQIYSDLNSSQEVVGGMMKIVPSDVDNDADYWLLSDADVSITDMWKTDCILHLNFCSSFFYLYLLFPSFGSQLDC
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHEEEEEHHHHHHccHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccEEEEEEccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccEEccccccccccccEEEccccccccccccccccccccccccccccEEEcccccccccc
********************************************************************CRYDSSLGLLTKKFINLIKHAEDGILDLNKAAETLEVQKRRIYDITNVLEGIGLIEKKLKNRIRWKGLDNSIPGEVDA***********************R*********IENENNRKWLFVTEEDIKNLHCFQNQTLIAIKAPQGTTLEVPDPDEAVDYPQRRYRIILRSTMGPIDVYLVSRF*************************************************************VVGGMMKIVPSDVDNDADYWLLSDADVSITDMWKTDCILHLNFCSSFFYLYLLFPSF******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDNEVETSEWVGSPGLTNISNGPFHTPVSAKGGRVNNRSKGIKGNRSTPQTPVSNAGSPSALTPAGSCRYDSSLGLLTKKFINLxxxxxxxxxxxxxxxxxxxxxKRRIYDITNVLEGIGLIEKKLKNRIRWKGLDNSIPGEVDADASILQADIDNLSMEELRxxxxxxxxxxxxxxxxxxxxxxKWLFVTEEDIKNLHCFQNQTLIAIKAPQGTTLEVPDPDEAVDYPQRRYRIILRSTMGPIDVYLVSRFEEKFEETNSVEPPASVPPVSSSDSNENQVKEIINVDRAGNETEAQAQQAHQIYSDLNSSQEVVGGMMKIVPSDVDNDADYWLLSDADVSITDMWKTDCILHLNFCSSFFYLYLLFPSFGSQLDC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor E2FA Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The binding of retinoblastoma-related proteins represses transactivation. Regulates gene expression both positively and negatively. Activates the expression of E2FB. Involved in the control of cell-cycle progression from G1 to S phase. Stimulates cell proliferation and delays differentiation.probableQ9FNY0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AZE, chain B
Confidence level:very confident
Coverage over the Query: 146-252
View the alignment between query and template
View the model in PyMOL
Template: 1CF7, chain A
Confidence level:very confident
Coverage over the Query: 69-134
View the alignment between query and template
View the model in PyMOL