BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 017121
         (377 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2
           Precursor From C.Elegans
          Length = 109

 Score = 29.3 bits (64), Expect = 3.6,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 113 IAKKKKIILCQMEMDRIQGSEEKLKARSFFKRIVGTVVRSVQDDQKEQD 161
           +AK  + +  +   DR++  EEKL A   F R++ T   +++DD+ + +
Sbjct: 33  LAKAYRALARKHHPDRVKNKEEKLLAEERF-RVIATAYETLKDDEAKTN 80


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.141    0.407 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,045,257
Number of Sequences: 62578
Number of extensions: 257600
Number of successful extensions: 780
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 779
Number of HSP's gapped (non-prelim): 13
length of query: 377
length of database: 14,973,337
effective HSP length: 100
effective length of query: 277
effective length of database: 8,715,537
effective search space: 2414203749
effective search space used: 2414203749
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)