Query         017170
Match_columns 376
No_of_seqs    203 out of 554
Neff          3.7 
Searched_HMMs 46136
Date          Fri Mar 29 06:13:15 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/017170.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/017170hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02309 AUX_IAA:  AUX/IAA fami 100.0 3.1E-68 6.6E-73  489.0   0.3  139  215-368    77-215 (215)
  2 PF00564 PB1:  PB1 domain;  Int  97.4 0.00032   7E-09   54.8   5.3   68  258-352     3-71  (84)
  3 smart00666 PB1 PB1 domain. Pho  97.1  0.0023 4.9E-08   50.0   7.2   66  258-351     3-69  (81)
  4 cd06398 PB1_Joka2 The PB1 doma  96.8  0.0036 7.9E-08   52.1   6.4   68  258-352     2-72  (91)
  5 cd05992 PB1 The PB1 domain is   96.8  0.0069 1.5E-07   47.0   7.2   66  258-351     2-69  (81)
  6 cd06407 PB1_NLP A PB1 domain i  96.7  0.0053 1.1E-07   50.2   6.4   56  258-340     2-57  (82)
  7 cd06396 PB1_NBR1 The PB1 domai  96.2   0.013 2.9E-07   48.3   6.0   53  259-339     3-55  (81)
  8 cd06401 PB1_TFG The PB1 domain  95.8   0.049 1.1E-06   45.2   7.4   74  258-356     2-79  (81)
  9 cd06404 PB1_aPKC PB1 domain is  95.1   0.056 1.2E-06   45.0   5.7   56  259-341     3-58  (83)
 10 cd06409 PB1_MUG70 The MUG70 pr  94.9   0.055 1.2E-06   45.1   5.1   52  266-340     7-60  (86)
 11 cd06402 PB1_p62 The PB1 domain  94.8   0.097 2.1E-06   43.7   6.5   60  257-341     1-65  (87)
 12 cd06403 PB1_Par6 The PB1 domai  94.8   0.069 1.5E-06   44.2   5.4   68  259-352     3-71  (80)
 13 cd06397 PB1_UP1 Uncharacterize  93.6    0.18   4E-06   41.9   5.6   66  259-352     3-69  (82)
 14 cd06408 PB1_NoxR The PB1 domai  90.2    0.85 1.8E-05   38.2   5.9   65  257-351     3-68  (86)
 15 cd06399 PB1_P40 The PB1 domain  77.7       4 8.7E-05   34.8   4.4   37  272-336    22-58  (92)
 16 PF10411 DsbC_N:  Disulfide bon  45.6      16 0.00035   27.7   2.0   17  325-341    34-50  (57)
 17 cd06406 PB1_P67 A PB1 domain i  42.5      92   0.002   26.0   6.1   66  257-351     3-69  (80)
 18 cd06395 PB1_Map2k5 PB1 domain   33.6      77  0.0017   27.0   4.3   50  264-340     9-58  (91)
 19 KOG3938 RGS-GAIP interacting p  31.1      74  0.0016   32.5   4.5   74  264-365    62-142 (334)
 20 PF09840 DUF2067:  Uncharacteri  28.4      25 0.00053   33.2   0.7   37  314-354    90-126 (190)
 21 PF11576 DUF3236:  Protein of u  25.1      26 0.00056   32.4   0.2   16   66-81     94-109 (154)
 22 KOG3606 Cell polarity protein   23.5 1.1E+02  0.0023   31.4   4.2   78  256-361    18-101 (358)
 23 COG3286 Uncharacterized protei  23.4      36 0.00077   32.9   0.8   37  314-354    93-129 (204)

No 1  
>PF02309 AUX_IAA:  AUX/IAA family;  InterPro: IPR003311 The Aux/IAA family of genes are key regulators of auxin-modified gene expression []. The plant hormone auxin (indole-3-acetic acid, IAA) regulates diverse cellular and developmental responses in plants, including cell division, expansion, differentiation and patterning of embryo responses []. Auxin can regulate the gene expression of several families, including GH3 and SAUR, as well as Aux/IAA itself. The Aux/IAA proteins act as repressors of auxin-induced gene expression, possibly through modulating the activity of DNA-binding auxin response factors (ARFs) (IPR010525 from INTERPRO). Aux/IAA and ARF are thought to interact through C-terminal protein-protein interaction domains found in both Aux/IAA and ARF. Recent evidence suggests that Aux/IAA proteins can also mediate light responses []. Some members of the AUX/IAA family are longer and contain an N-terminal DNA binding domain [] and may have an early function in the establishment of vascular and body patterns in embryonic and post-embryonic development in some plants.; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2P1N_F 2P1Q_C 2P1O_C.
Probab=100.00  E-value=3.1e-68  Score=489.01  Aligned_cols=139  Identities=70%  Similarity=1.156  Sum_probs=6.0

Q ss_pred             CCCCcccCCccCCCCcccccccccccccCCCCCCCCCCCCCccceEEeecCCccCceecCCCCCChHHHHHHHHHhhccc
Q 017170          215 MSAPAAKAQVVGWPPIRSFRKNSLATTSKNNDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCF  294 (376)
Q Consensus       215 ~~~pa~kaqVVGWPPVrS~RKN~l~~~~k~~~e~~~~~~~~~~fVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~  294 (376)
                      ...|++++|+||||||++||||.+..         .+....++||||+|||+||||||||++|+||++|+.+|++||.+|
T Consensus        77 ~~~p~~~~~~vgwpp~~s~r~n~~~~---------~~~~~~~~~vKV~mdG~~igRkVDL~~~~sY~~L~~~L~~MF~~~  147 (215)
T PF02309_consen   77 SSPPASKAQVVGWPPVRSFRKNSLSE---------KQSSSSRSYVKVNMDGVPIGRKVDLSAYSSYEELSSALEKMFSCF  147 (215)
T ss_dssp             ---------BTTBS----S-------------------------------------------------------------
T ss_pred             CCCCcccccccCCCcccccccccccc---------cccccCCceeEEEecCcccceecCHHHhhCHHHHHHHHHHhcCCC
Confidence            45577889999999999999998771         112234799999999999999999999999999999999999999


Q ss_pred             cccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeEEccCCChhHHHhhceeeEEecCCcccCcchhH
Q 017170          295 TIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRA  368 (376)
Q Consensus       295 ~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwMLVGDVPWemFv~svKRLrImk~Sea~glapr~  368 (376)
                      .|.+|++++      +++..+.+++++++|+|||||+||||||||||||+|||.+|||||||+.+|++||+||+
T Consensus       148 ~i~~~~~~~------~~~~~~~~~~~~~~~~l~Y~D~egd~mlvGD~PW~~F~~~vkRl~I~~~~e~~~~~~r~  215 (215)
T PF02309_consen  148 SIEQCGSHG------LNESGLLDLLNGSEYVLVYEDKEGDWMLVGDVPWEEFVKSVKRLRIMKSSEAKGLAPRA  215 (215)
T ss_dssp             --------------------------------------------------------------------------
T ss_pred             Ccccccccc------ccchhhccccCCcceeEEEECCCCCEEEecCCCHHHHHHHhhccEEecHHHhcccCCCC
Confidence            999998744      34566677788899999999999999999999999999999999999999999999996


No 2  
>PF00564 PB1:  PB1 domain;  InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.; GO: 0005515 protein binding; PDB: 1IPG_A 1IP9_A 2KFK_A 1WMH_A 1VD2_A 1WI0_A 1OEY_C 1PQS_A 1Q1O_A 1TZ1_A ....
Probab=97.39  E-value=0.00032  Score=54.77  Aligned_cols=68  Identities=24%  Similarity=0.458  Sum_probs=54.9

Q ss_pred             ceEEeecCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeEE
Q 017170          258 FIKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWML  337 (376)
Q Consensus       258 fVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwML  337 (376)
                      -|||+..|. +=|.+.+..--+|++|...+++.|...                          ...+.|.|.|.||||..
T Consensus         3 ~vK~~~~~~-~~~~~~~~~~~s~~~L~~~i~~~~~~~--------------------------~~~~~l~Y~D~dgD~V~   55 (84)
T PF00564_consen    3 RVKVRYGGD-IRRIISLPSDVSFDDLRSKIREKFGLL--------------------------DEDFQLKYKDEDGDLVT   55 (84)
T ss_dssp             EEEEEETTE-EEEEEEECSTSHHHHHHHHHHHHHTTS--------------------------TSSEEEEEEETTSSEEE
T ss_pred             EEEEEECCe-eEEEEEcCCCCCHHHHHHHHHHHhCCC--------------------------CccEEEEeeCCCCCEEE
Confidence            489999997 333588888889999999999999751                          24799999999999998


Q ss_pred             ccC-CChhHHHhhcee
Q 017170          338 VGD-VPWEMFIDSCKR  352 (376)
Q Consensus       338 VGD-VPWemFv~svKR  352 (376)
                      +-+ .=|++.+..+++
T Consensus        56 i~sd~Dl~~a~~~~~~   71 (84)
T PF00564_consen   56 ISSDEDLQEAIEQAKE   71 (84)
T ss_dssp             ESSHHHHHHHHHHHHH
T ss_pred             eCCHHHHHHHHHHHHh
Confidence            875 568888887753


No 3  
>smart00666 PB1 PB1 domain. Phox and Bem1p domain, present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.
Probab=97.10  E-value=0.0023  Score=50.04  Aligned_cols=66  Identities=23%  Similarity=0.420  Sum_probs=52.2

Q ss_pred             ceEEeecCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeEE
Q 017170          258 FIKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWML  337 (376)
Q Consensus       258 fVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwML  337 (376)
                      =|||+-.|.  -|.+-+..--+|++|...+.+.|..                          ....+.|.|+|.||||..
T Consensus         3 ~vK~~~~~~--~~~~~~~~~~s~~dL~~~i~~~~~~--------------------------~~~~~~l~Y~Dedgd~v~   54 (81)
T smart00666        3 DVKLRYGGE--TRRLSVPRDISFEDLRSKVAKRFGL--------------------------DNQSFTLKYQDEDGDLVS   54 (81)
T ss_pred             cEEEEECCE--EEEEEECCCCCHHHHHHHHHHHhCC--------------------------CCCCeEEEEECCCCCEEE
Confidence            378887554  6777788889999999999999974                          113689999999999987


Q ss_pred             ccC-CChhHHHhhce
Q 017170          338 VGD-VPWEMFIDSCK  351 (376)
Q Consensus       338 VGD-VPWemFv~svK  351 (376)
                      +.+ .=|.+.+..++
T Consensus        55 l~sd~Dl~~a~~~~~   69 (81)
T smart00666       55 LTSDEDLEEAIEEYD   69 (81)
T ss_pred             ecCHHHHHHHHHHHH
Confidence            665 57777777666


No 4  
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=96.81  E-value=0.0036  Score=52.13  Aligned_cols=68  Identities=25%  Similarity=0.311  Sum_probs=52.6

Q ss_pred             ceEEeecCCccCceecCC---CCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCC
Q 017170          258 FIKVSMDGAPYLRKVDLR---TYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGD  334 (376)
Q Consensus       258 fVKV~MDG~pIGRKVDL~---~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGD  334 (376)
                      -|||.-+|.-+=-++++.   ..-+|++|...+.+.|...                         ...+|+|.|.|.|||
T Consensus         2 ~vKv~y~~~~rRf~l~~~~~~~d~~~~~L~~kI~~~f~l~-------------------------~~~~~~l~Y~Dedgd   56 (91)
T cd06398           2 VVKVKYGGTLRRFTFPVAENQLDLNMDGLREKVEELFSLS-------------------------PDADLSLTYTDEDGD   56 (91)
T ss_pred             EEEEEeCCEEEEEEeccccccCCCCHHHHHHHHHHHhCCC-------------------------CCCcEEEEEECCCCC
Confidence            489999998555555554   4679999999999999751                         125799999999999


Q ss_pred             eEEccCCChhHHHhhcee
Q 017170          335 WMLVGDVPWEMFIDSCKR  352 (376)
Q Consensus       335 wMLVGDVPWemFv~svKR  352 (376)
                      |..+-+.  +.|...+.+
T Consensus        57 ~V~l~~D--~DL~~a~~~   72 (91)
T cd06398          57 VVTLVDD--NDLTDAIQY   72 (91)
T ss_pred             EEEEccH--HHHHHHHHH
Confidence            9988776  666655554


No 5  
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as a noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=96.75  E-value=0.0069  Score=46.99  Aligned_cols=66  Identities=23%  Similarity=0.411  Sum_probs=51.6

Q ss_pred             ceEEeecCCccCceecCC-CCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeE
Q 017170          258 FIKVSMDGAPYLRKVDLR-TYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWM  336 (376)
Q Consensus       258 fVKV~MDG~pIGRKVDL~-~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwM  336 (376)
                      -|||+-.|.  -|.+=+. ..-+|++|...|.+.|...                          ...+.+.|.|.||||.
T Consensus         2 ~vK~~~~~~--~~~~~~~~~~~s~~~L~~~i~~~~~~~--------------------------~~~~~l~y~D~e~d~v   53 (81)
T cd05992           2 RVKVKYGGE--IRRFVVVSRSISFEDLRSKIAEKFGLD--------------------------AVSFKLKYPDEDGDLV   53 (81)
T ss_pred             cEEEEecCC--CEEEEEecCCCCHHHHHHHHHHHhCCC--------------------------CCcEEEEeeCCCCCEE
Confidence            378888875  4445455 8889999999999999741                          0368999999999999


Q ss_pred             EccC-CChhHHHhhce
Q 017170          337 LVGD-VPWEMFIDSCK  351 (376)
Q Consensus       337 LVGD-VPWemFv~svK  351 (376)
                      .+.+ .=|++.++.++
T Consensus        54 ~l~sd~Dl~~a~~~~~   69 (81)
T cd05992          54 TISSDEDLEEAIEEAR   69 (81)
T ss_pred             EeCCHHHHHHHHHHHh
Confidence            8887 57777777765


No 6  
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium). The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes like osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-inte
Probab=96.68  E-value=0.0053  Score=50.15  Aligned_cols=56  Identities=23%  Similarity=0.339  Sum_probs=44.4

Q ss_pred             ceEEeecCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeEE
Q 017170          258 FIKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWML  337 (376)
Q Consensus       258 fVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwML  337 (376)
                      =|||...|.  -+.+-|..--+|++|...+.++|..-                         +.+.|.|-|.|.||||.+
T Consensus         2 ~vK~~~~~d--~~r~~l~~~~~~~~L~~~i~~r~~~~-------------------------~~~~f~LkY~Ddegd~v~   54 (82)
T cd06407           2 RVKATYGEE--KIRFRLPPSWGFTELKQEIAKRFKLD-------------------------DMSAFDLKYLDDDEEWVL   54 (82)
T ss_pred             EEEEEeCCe--EEEEEcCCCCCHHHHHHHHHHHhCCC-------------------------CCCeeEEEEECCCCCeEE
Confidence            389999887  45566666669999999999999740                         125799999999999987


Q ss_pred             ccC
Q 017170          338 VGD  340 (376)
Q Consensus       338 VGD  340 (376)
                      +--
T Consensus        55 lts   57 (82)
T cd06407          55 LTC   57 (82)
T ss_pred             eec
Confidence            643


No 7  
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The NBR1 protein contains a type I PB1 domain.
Probab=96.19  E-value=0.013  Score=48.28  Aligned_cols=53  Identities=17%  Similarity=0.292  Sum_probs=45.5

Q ss_pred             eEEeecCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeEEc
Q 017170          259 IKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLV  338 (376)
Q Consensus       259 VKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwMLV  338 (376)
                      |||.-.|.-+--+++-+..-+|++|...+.++|..                          +  .+.|.|-|.||||.++
T Consensus         3 vKaty~~d~~rf~~~~~~~~~~~~L~~ev~~rf~l--------------------------~--~f~lKYlDde~e~v~l   54 (81)
T cd06396           3 LKVTYNGESQSFLVSDSENTTWASVEAMVKVSFGL--------------------------N--DIQIKYVDEENEEVSV   54 (81)
T ss_pred             EEEEECCeEEEEEecCCCCCCHHHHHHHHHHHhCC--------------------------C--cceeEEEcCCCCEEEE
Confidence            78999998777777777788999999999999974                          1  4789999999999876


Q ss_pred             c
Q 017170          339 G  339 (376)
Q Consensus       339 G  339 (376)
                      -
T Consensus        55 s   55 (81)
T cd06396          55 N   55 (81)
T ss_pred             E
Confidence            4


No 8  
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK. The PB1 domain is a modular domain mediating specific protein-protein interaction in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The PB1 domains of TFG represent a type I/II PB1 domain. The physiological function of TFG remains unknown.
Probab=95.75  E-value=0.049  Score=45.16  Aligned_cols=74  Identities=18%  Similarity=0.409  Sum_probs=50.5

Q ss_pred             ceEEeecCCccCceecCCCCC-ChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeE
Q 017170          258 FIKVSMDGAPYLRKVDLRTYT-NYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWM  336 (376)
Q Consensus       258 fVKV~MDG~pIGRKVDL~~y~-sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwM  336 (376)
                      -+|+.-.|.  -|++=+..-. +|.+|...+.+.|....                       .....+.+.|.|.|||+.
T Consensus         2 iiK~~~g~D--iR~~~~~~~~~t~~~L~~~v~~~F~~~~-----------------------~~~~~flIKYkD~dGDlV   56 (81)
T cd06401           2 ILKAQLGDD--IRRIPIHNEDITYDELLLMMQRVFRGKL-----------------------GSSDDVLIKYKDEDGDLI   56 (81)
T ss_pred             eEEEEeCCe--EEEEeccCccccHHHHHHHHHHHhcccc-----------------------CCcccEEEEEECCCCCEE
Confidence            367777666  4665555433 99999999999997410                       112479999999999999


Q ss_pred             EccCC---ChhHHHhhceeeEEe
Q 017170          337 LVGDV---PWEMFIDSCKRLKIM  356 (376)
Q Consensus       337 LVGDV---PWemFv~svKRLrIm  356 (376)
                      =+.+-   -|..=+...+||+|.
T Consensus        57 TIts~~dL~~A~~~~~~~~l~~~   79 (81)
T cd06401          57 TIFDSSDLSFAIQCSRILKLTLF   79 (81)
T ss_pred             EeccHHHHHHHHhcCcceEEEEe
Confidence            99875   343334444555553


No 9  
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=95.07  E-value=0.056  Score=45.00  Aligned_cols=56  Identities=18%  Similarity=0.344  Sum_probs=44.6

Q ss_pred             eEEeecCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeEEc
Q 017170          259 IKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLV  338 (376)
Q Consensus       259 VKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwMLV  338 (376)
                      ||++-.|.-.--.+|.  .-+|++|.+.+.+||..                         ..+..|++.|.|.|||---+
T Consensus         3 ~K~~y~gdi~it~~d~--~~s~e~L~~~v~~~c~~-------------------------~~~q~ft~kw~DEEGDp~ti   55 (83)
T cd06404           3 VKAAYNGDIMITSIDP--SISLEELCNEVRDMCRF-------------------------HNDQPFTLKWIDEEGDPCTI   55 (83)
T ss_pred             EEEEecCcEEEEEcCC--CcCHHHHHHHHHHHhCC-------------------------CCCCcEEEEEECCCCCceee
Confidence            7999999855555665  77899999999999974                         12357999999999998766


Q ss_pred             cCC
Q 017170          339 GDV  341 (376)
Q Consensus       339 GDV  341 (376)
                      ...
T Consensus        56 SS~   58 (83)
T cd06404          56 SSQ   58 (83)
T ss_pred             cCH
Confidence            543


No 10 
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domains depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic amino acid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is
Probab=94.85  E-value=0.055  Score=45.07  Aligned_cols=52  Identities=23%  Similarity=0.352  Sum_probs=38.4

Q ss_pred             CccCceecCC--CCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeEEccC
Q 017170          266 APYLRKVDLR--TYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGD  340 (376)
Q Consensus       266 ~pIGRKVDL~--~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwMLVGD  340 (376)
                      .|-||.+=++  ...+|.+|..++.+-|+.-.                      . ....|.|.|.|.||||.|.--
T Consensus         7 ~~~GrvhRf~~~~s~~~~~L~~~I~~Rl~~d~----------------------~-~~~~~~L~YlDDEgD~VllT~   60 (86)
T cd06409           7 DPKGRVHRFRLRPSESLEELRTLISQRLGDDD----------------------F-ETHLYALSYVDDEGDIVLITS   60 (86)
T ss_pred             CCCCCEEEEEecCCCCHHHHHHHHHHHhCCcc----------------------c-cCCcccEEEEcCCCCEEEEec
Confidence            4567765544  37899999999999997510                      0 024699999999999988653


No 11 
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover. The PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=94.84  E-value=0.097  Score=43.71  Aligned_cols=60  Identities=25%  Similarity=0.449  Sum_probs=43.9

Q ss_pred             cceEEeecC---CccCcee--cCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcC
Q 017170          257 LFIKVSMDG---APYLRKV--DLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDK  331 (376)
Q Consensus       257 ~fVKV~MDG---~pIGRKV--DL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDk  331 (376)
                      +.||.+..|   .+=-|++  |=....+|++|...+.++|..                         +.+..|+|.|.|.
T Consensus         1 ~~vkayl~~~~~~~EIRRf~l~~~~~~s~~~L~~~V~~~f~~-------------------------l~~~~ftlky~De   55 (87)
T cd06402           1 LTVKAYLLGKDANAEIRRFAIDEDVSTSYEYLVEKVAAVFPS-------------------------LRGKNFQLFWKDE   55 (87)
T ss_pred             CeEEEeecCCCCccceEEEEecCCCCcCHHHHHHHHHHHccc-------------------------cCCCcEEEEEECC
Confidence            357777776   2233444  446667999999999999963                         1235799999999


Q ss_pred             CCCeEEccCC
Q 017170          332 DGDWMLVGDV  341 (376)
Q Consensus       332 EGDwMLVGDV  341 (376)
                      |||..-+...
T Consensus        56 eGDlvtIssd   65 (87)
T cd06402          56 EGDLVAFSSD   65 (87)
T ss_pred             CCCEEeecCH
Confidence            9999776653


No 12 
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The
Probab=94.78  E-value=0.069  Score=44.24  Aligned_cols=68  Identities=16%  Similarity=0.275  Sum_probs=48.8

Q ss_pred             eEEeecCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeEEc
Q 017170          259 IKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLV  338 (376)
Q Consensus       259 VKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwMLV  338 (376)
                      ||..-|..=-=-.+|.....+|++++.-|++||...                          ...|+|-|.|.+||.+-+
T Consensus         3 VKSkfdaEfRRFsl~r~~~~~f~ef~~ll~~lH~l~--------------------------~~~f~i~Y~D~~gDLLPI   56 (80)
T cd06403           3 VKSKFDAEFRRFSLDRNKPGKFEDFYKLLEHLHHIP--------------------------NVDFLIGYTDPHGDLLPI   56 (80)
T ss_pred             eecccCCeEEEEEeccccCcCHHHHHHHHHHHhCCC--------------------------CCcEEEEEeCCCCCEecc
Confidence            666666662222455555699999999999999751                          247999999999999977


Q ss_pred             c-CCChhHHHhhcee
Q 017170          339 G-DVPWEMFIDSCKR  352 (376)
Q Consensus       339 G-DVPWemFv~svKR  352 (376)
                      - |+-+..=++++++
T Consensus        57 nNDdNf~kAlssa~p   71 (80)
T cd06403          57 NNDDNFLKALSSANP   71 (80)
T ss_pred             cCcHHHHHHHHcCCC
Confidence            5 4455555667763


No 13 
>cd06397 PB1_UP1 Uncharacterized protein 1. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=93.59  E-value=0.18  Score=41.94  Aligned_cols=66  Identities=23%  Similarity=0.320  Sum_probs=50.4

Q ss_pred             eEEeecCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeEEc
Q 017170          259 IKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLV  338 (376)
Q Consensus       259 VKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwMLV  338 (376)
                      -||+-+|.  .|++-...-=+|..|.+.|+.+|....                          ..+.|||.|.|||..=+
T Consensus         3 fKv~~~g~--~RRf~~~~~pt~~~L~~kl~~Lf~lp~--------------------------~~~~vtYiDeD~D~ITl   54 (82)
T cd06397           3 FKSSFLGD--TRRIVFPDIPTWEALASKLENLYNLPE--------------------------IKVGVTYIDNDNDEITL   54 (82)
T ss_pred             EEEEeCCc--eEEEecCCCccHHHHHHHHHHHhCCCh--------------------------hHeEEEEEcCCCCEEEe
Confidence            48888887  899988888999999999999998621                          13789999999998755


Q ss_pred             cC-CChhHHHhhcee
Q 017170          339 GD-VPWEMFIDSCKR  352 (376)
Q Consensus       339 GD-VPWemFv~svKR  352 (376)
                      -| .=.+.|..-..|
T Consensus        55 ssd~eL~d~~~~~~~   69 (82)
T cd06397          55 SSNKELQDFYRLSHR   69 (82)
T ss_pred             cchHHHHHHHHhccc
Confidence            44 555555553333


No 14 
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA.  NoxA is essential for growth control of the fungal endophyte in plant tissue in the process of symbiotic interaction between a fungi and its plant host.   The Epichloe festucae p67(phox)-like regulator, NoxR, dispensable in culture but essential in plants for the symbiotic interaction. Plants infected with a noxR deletion mutant show severe stunting and premature senescence, whereas hyphae in the meristematic tissues show increased branching leading to increased fungal colonization of pseudostem and leaf blade tissue.  The PB1 domain is a modular domain mediating specific protein-protein interactions which a play role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is 
Probab=90.21  E-value=0.85  Score=38.19  Aligned_cols=65  Identities=20%  Similarity=0.402  Sum_probs=50.4

Q ss_pred             cceEEeecCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeE
Q 017170          257 LFIKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWM  336 (376)
Q Consensus       257 ~fVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwM  336 (376)
                      .-|||+-.|.  .|-|-+..--+|++|...+.++|..                           ...++|-|.|. ||..
T Consensus         3 ikVKv~~~~D--v~~i~v~~~i~f~dL~~kIrdkf~~---------------------------~~~~~iKykDE-GD~i   52 (86)
T cd06408           3 IRVKVHAQDD--TRYIMIGPDTGFADFEDKIRDKFGF---------------------------KRRLKIKMKDD-GDMI   52 (86)
T ss_pred             EEEEEEecCc--EEEEEcCCCCCHHHHHHHHHHHhCC---------------------------CCceEEEEEcC-CCCc
Confidence            4589999898  6677777777899999999999974                           13689999999 9998


Q ss_pred             EccCC-ChhHHHhhce
Q 017170          337 LVGDV-PWEMFIDSCK  351 (376)
Q Consensus       337 LVGDV-PWemFv~svK  351 (376)
                      -++|- =.++-+.++|
T Consensus        53 ti~sq~DLd~Ai~~a~   68 (86)
T cd06408          53 TMGDQDDLDMAIDTAR   68 (86)
T ss_pred             cccCHHHHHHHHHHHH
Confidence            88874 3344455554


No 15 
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes , such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The PB1 domain of p40 represents a type I PB1 domain which interacts with the PB1 domain of oxidase activator p67 w
Probab=77.75  E-value=4  Score=34.77  Aligned_cols=37  Identities=24%  Similarity=0.413  Sum_probs=30.7

Q ss_pred             ecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeE
Q 017170          272 VDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWM  336 (376)
Q Consensus       272 VDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwM  336 (376)
                      =||+..-.|.+|..-..+-|..                            .+-.|-|.|.|||..
T Consensus        22 e~l~~~P~~kdLl~lmr~~f~~----------------------------~dIaLNYrD~EGDLI   58 (92)
T cd06399          22 EDLSSTPLLKDLLELTRREFQR----------------------------EDIALNYRDAEGDLI   58 (92)
T ss_pred             cccccCccHHHHHHHHHHHhch----------------------------hheeeeeecCCCCEE
Confidence            3788888999999999998864                            145789999999984


No 16 
>PF10411 DsbC_N:  Disulfide bond isomerase protein N-terminus;  InterPro: IPR018950  This is the N-terminal domain of the disulphide bond isomerase DsbC. The whole molecule is V-shaped, where each arm is a DsbC monomer of two domains linked by a hinge; and the N-termini of each monomer join to form the dimer interface at the base of the V, so are vital for dimerisation []. DsbC is required for disulphide bond formation and functions as a disulphide bond isomerase during oxidative protein-folding in bacterial periplasm. It also has chaperone activity []. ; PDB: 1EEJ_B 2IYJ_A 1TJD_A 1JZD_B 1JZO_A 1G0T_B 1T3B_A.
Probab=45.65  E-value=16  Score=27.71  Aligned_cols=17  Identities=29%  Similarity=0.755  Sum_probs=14.5

Q ss_pred             EEEEEcCCCCeEEccCC
Q 017170          325 VLTYEDKDGDWMLVGDV  341 (376)
Q Consensus       325 vLtYEDkEGDwMLVGDV  341 (376)
                      -+.|.|.||+++++|+.
T Consensus        34 ~i~Y~~~dg~yli~G~l   50 (57)
T PF10411_consen   34 GILYVDEDGRYLIQGQL   50 (57)
T ss_dssp             EEEEEETTSSEEEES-E
T ss_pred             eEEEEcCCCCEEEEeEE
Confidence            47899999999999974


No 17 
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of  NADPH oxidase during phagocytosis. PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes . A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The p67 proteins contain
Probab=42.54  E-value=92  Score=25.97  Aligned_cols=66  Identities=14%  Similarity=0.204  Sum_probs=49.0

Q ss_pred             cceEEeecCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCC-Ce
Q 017170          257 LFIKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDG-DW  335 (376)
Q Consensus       257 ~fVKV~MDG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEG-Dw  335 (376)
                      .-|||+-.+   .=.|-...--+|.+|...|.+-+...                          +.+-+|-|.|.+. +.
T Consensus         3 ~vvKV~f~~---tIaIrvp~~~~y~~L~~ki~~kLkl~--------------------------~e~i~LsYkde~s~~~   53 (80)
T cd06406           3 YVVKVHFKY---TVAIQVARGLSYATLLQKISSKLELP--------------------------AEHITLSYKSEASGED   53 (80)
T ss_pred             eEEEEEEEE---EEEEEcCCCCCHHHHHHHHHHHhCCC--------------------------chhcEEEeccCCCCCc
Confidence            458999997   33455566678999999999888641                          2346799998874 44


Q ss_pred             EEccCCChhHHHhhce
Q 017170          336 MLVGDVPWEMFIDSCK  351 (376)
Q Consensus       336 MLVGDVPWemFv~svK  351 (376)
                      ..++|-=|+.-.+.||
T Consensus        54 v~l~d~dle~aws~~~   69 (80)
T cd06406          54 VILSDTNMEDVWSQAK   69 (80)
T ss_pred             cCcChHHHHHHHHhhc
Confidence            4559998998888887


No 18 
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development. The PB1 domain of Map2k5 interacts with the PB1 domain of another members of kinase cascade MEKK2 (or MEKK3).  A canonical PB1-PB1 interaction, involving heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The Map2k5 protein contains a type I PB1 domain.
Probab=33.55  E-value=77  Score=27.02  Aligned_cols=50  Identities=20%  Similarity=0.308  Sum_probs=35.0

Q ss_pred             cCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCCCeEEccC
Q 017170          264 DGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGD  340 (376)
Q Consensus       264 DG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEGDwMLVGD  340 (376)
                      +|..+--.||...+=+|.++..++.+....-+                           --.+-|||.|||+.-|--
T Consensus         9 ~gg~vDw~V~~~~~L~F~DvL~~I~~vlp~aT---------------------------~tAFeYEDE~gDRITVRS   58 (91)
T cd06395           9 NGGAVDWTVQSGPQLLFRDVLDVIGQVLPEAT---------------------------TTAFEYEDEDGDRITVRS   58 (91)
T ss_pred             CCCcccccccCcccccHHHHHHHHHHhccccc---------------------------ccceeeccccCCeeEecc
Confidence            34446667777777889999888877764311                           123669999999987743


No 19 
>KOG3938 consensus RGS-GAIP interacting protein GIPC, contains PDZ domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=31.14  E-value=74  Score=32.46  Aligned_cols=74  Identities=28%  Similarity=0.455  Sum_probs=51.6

Q ss_pred             cCCccCceecCCCCCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEc--CCCCeEEccCC
Q 017170          264 DGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYED--KDGDWMLVGDV  341 (376)
Q Consensus       264 DG~pIGRKVDL~~y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYED--kEGDwMLVGDV  341 (376)
                      .|.|.||   +..|++-+||++.+.+-|.+..           .         |.     .-+|.-+  -|=+.||-|-.
T Consensus        62 HGSptg~---Ie~fsnv~ELY~kIAe~F~Is~-----------~---------dI-----lfcTlNshKvDM~~llgGqi  113 (334)
T KOG3938|consen   62 HGSPTGR---IEGFSNVRELYQKIAEAFDISP-----------D---------DI-----LFCTLNSHKVDMKRLLGGQI  113 (334)
T ss_pred             cCCccce---ecccccHHHHHHHHHHHhcCCc-----------c---------ce-----EEEecCCCcccHHHHhcCcc
Confidence            4667777   4568999999999999998621           0         00     0122222  23445888888


Q ss_pred             ChhHHHh-----hceeeEEecCCcccCcc
Q 017170          342 PWEMFID-----SCKRLKIMKGSDAIGLA  365 (376)
Q Consensus       342 PWemFv~-----svKRLrImk~Sea~gla  365 (376)
                      -.+.|+=     -.|-++|+|+.++.||.
T Consensus       114 gleDfiFAHvkGq~kEv~v~KsedalGlT  142 (334)
T KOG3938|consen  114 GLEDFIFAHVKGQAKEVEVVKSEDALGLT  142 (334)
T ss_pred             ChhhhhhhhhcCcceeEEEEecccccceE
Confidence            8888863     56789999999998884


No 20 
>PF09840 DUF2067:  Uncharacterized protein conserved in archaea (DUF2067);  InterPro: IPR019202  This family of archaeal proteins, have no known function. 
Probab=28.41  E-value=25  Score=33.19  Aligned_cols=37  Identities=27%  Similarity=0.419  Sum_probs=30.6

Q ss_pred             hhhcccCCCceEEEEEcCCCCeEEccCCChhHHHhhceeeE
Q 017170          314 KLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLK  354 (376)
Q Consensus       314 ~L~dll~gseyvLtYEDkEGDwMLVGDVPWemFv~svKRLr  354 (376)
                      -|.+.|.-.+|..-|.+.    .|..|.||+.+++.++||.
T Consensus        90 ~L~~~L~~~G~~ae~~~~----~i~T~a~~eev~~l~~~Ls  126 (190)
T PF09840_consen   90 LLVDALKLLGYKAEYRED----VIKTDAPLEEVVELAERLS  126 (190)
T ss_pred             HHHHHHHhCCCeeEEeCC----eEEecCCHHHHHHHHHHHH
Confidence            356666667899999766    8899999999999999873


No 21 
>PF11576 DUF3236:  Protein of unknown function (DUF3236);  InterPro: IPR012019  This family of proteins with unknown function appears to be restricted to Methanobacteria. ; PDB: 3BRC_B.
Probab=25.10  E-value=26  Score=32.43  Aligned_cols=16  Identities=50%  Similarity=0.733  Sum_probs=9.5

Q ss_pred             ccccchhccCCCCCCC
Q 017170           66 NLKATELRLGLPGSES   81 (376)
Q Consensus        66 nlkaTELRLGLPGs~s   81 (376)
                      ||=-..=|||.|||.|
T Consensus        94 DlvIARGRLGvPGSGS  109 (154)
T PF11576_consen   94 DLVIARGRLGVPGSGS  109 (154)
T ss_dssp             SEEEEEEE-SSTTS-E
T ss_pred             cEEEEcccccCCCCcc
Confidence            3334455999999985


No 22 
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms]
Probab=23.51  E-value=1.1e+02  Score=31.42  Aligned_cols=78  Identities=24%  Similarity=0.400  Sum_probs=56.1

Q ss_pred             ccceEEeecCCccCceecCCC--CCChHHHHHHHHHhhccccccCCCCCCCCcccccchhhhhcccCCCceEEEEEcCCC
Q 017170          256 ALFIKVSMDGAPYLRKVDLRT--YTNYGELSSALEKMFSCFTIGQCGSHEAPGREMLSESKLKDLLHGSEYVLTYEDKDG  333 (376)
Q Consensus       256 ~~fVKV~MDG~pIGRKVDL~~--y~sY~eLs~aLe~MF~~~~~g~~gs~g~~~~e~~~e~~L~dll~gseyvLtYEDkEG  333 (376)
                      .+-||-..|-.  =|..-|..  -.+|++.+.-|+++-.+.                          +.++.|-|.|.-|
T Consensus        18 ~veVKSKFdaE--fRRfsl~r~~~~~f~~F~~Lv~~~H~i~--------------------------nvdvllgY~d~hg   69 (358)
T KOG3606|consen   18 TVEVKSKFDAE--FRRFSLPRHSASSFDEFYSLVEHLHHIP--------------------------NVDVLLGYADTHG   69 (358)
T ss_pred             eEEeeccccch--hheecccccCcccHHHHHHHHHHHhcCC--------------------------CceEEEEEecCCC
Confidence            45566555554  45555544  468999999999888651                          2468899999999


Q ss_pred             CeEEcc-CCChhHHHhhce---eeEEecCCcc
Q 017170          334 DWMLVG-DVPWEMFIDSCK---RLKIMKGSDA  361 (376)
Q Consensus       334 DwMLVG-DVPWemFv~svK---RLrImk~Sea  361 (376)
                      |.+-+- |.-+.--+++++   ||.|-|..||
T Consensus        70 DLLPinNDDn~~ka~~sa~PlLR~~iQkr~ea  101 (358)
T KOG3606|consen   70 DLLPINNDDNLHKALSSARPLLRLLIQKREEA  101 (358)
T ss_pred             ceecccCchhHHHHhhccCchhhhhhhhhhhh
Confidence            999764 566666677777   7888888776


No 23 
>COG3286 Uncharacterized protein conserved in archaea [Function unknown]
Probab=23.41  E-value=36  Score=32.87  Aligned_cols=37  Identities=22%  Similarity=0.398  Sum_probs=30.4

Q ss_pred             hhhcccCCCceEEEEEcCCCCeEEccCCChhHHHhhceeeE
Q 017170          314 KLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLK  354 (376)
Q Consensus       314 ~L~dll~gseyvLtYEDkEGDwMLVGDVPWemFv~svKRLr  354 (376)
                      -|.|.|..-+|.+-|.+.+    |=-+.||..|++.|++|.
T Consensus        93 vl~daLk~~GyrVevr~~~----l~T~ap~~ev~E~vreLs  129 (204)
T COG3286          93 VLIDALKLLGYRVEVRGGE----LKTNAPWSEVVELVRELS  129 (204)
T ss_pred             HHHHHHHhCCceEEeeCce----eecCCCHHHHHHHHHHHH
Confidence            4667777778999997554    888999999999999863


Done!