Citrus Sinensis ID: 017242

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----

MASLTPPSTAVQPGRIRVLKQGSLDKKRGPVVYWMFRDQRVRDNWALIHAVDQANKNNVPVAVAFNLFDQFLGAKARQLGFMLRGLRLLQRNIEETFQILFFLFQGEAEDNIPNFVRECGASLLVTDFSPLREIRRCKDKICNRVSDSVTIHEVDAHNVVPVWVASEKLEYSAKTLRGKINKLLPEYLIDYPMLEQPIEKWTGTRQSIDWDSIIAAVLRKGAEVPEIGWCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCALEARKARKLCPEAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIYTKEQFEKAQTADPVSIYLWMFILD

ccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEECcccccHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHcccccCEEEEcccCEEEEEEEccccccccccccHHHHHHcccccccccccccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHccHHHHHHHHccccHHcccccccccccccccHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccHHHHHHcccccHHHHHHHHHHHc

**************************KRGPVVYWMFRDQRVRDNWALIHAVDQANKNNVPVAVAFNLFDQFLGAKARQLGFMLRGLRLLQRNIEETFQILFFLFQGEAEDNIPNFVRECGASLLVTDFSPLREIRRCKDKICNRVSDSVTIHEVDAHNVVPVWVASEKLEYSAKTLRGKINKLLPEYLIDYPMLEQPIEKWTGTRQSIDWDSIIAAVLRKGAEVPEIGWCESGEDAAMEVLKGSKDGFLTKRLKNYPTDRNNPLKPRALSGLSPYLHFGQISAQRCALEARKARKLCPEAIDTFLEELIVRRELADNFCFYQPNYDSLKGAWEWARKSLKDHASDKREHIYTKEQFEKAQTADPVSIYLWMFILD

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Deoxyribodipyrimidine photo-lyase	Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutylpyrimidine dimers (CPDs), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation. Required for plant survival in the presence of UV-B light. Not involved in the repair of (6-4) photoproducts.	probable	Q9SB00
Deoxyribodipyrimidine photo-lyase	Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutylpyrimidine dimers (CPDs), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation. Required for plant survival in the presence of UV-B light. Not involved in the repair of (6-4) photoproducts.	probable	Q6F6A2

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UMV, chain A
Confidence level:very confident
Coverage over the Query: 9-373
View the alignment between query and template
View the model in PyMOL