Citrus Sinensis ID: 017247

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----

MAFGDEQYPSSFLLDALYCEEEELEDEVIDQEDDECSQNKNPACLFSLLLLEQDLFWEDEELLSLFSKEEQQLLKQETQTHYKDSDVLVVARSEAVEWVLKVNAHYGFSTLTAILAINYLDRFLRSFHFQIDKPWMIQLLAVTCLSLAAKVEETQVPLLLDLQVEGAKYVFETKAIQRMELLVLSTLEWKMHPVTPISFLDHIIRRLGLKTSLHWEFLKRCERLLLTLVSDSRSVSYLPSVLATATMMHIIDQVEPVNPVDYQNQLLGVLKISKEKVSDCYKLILELANAKTNANSNPHKRKFEAIPGSPGGVIDATVFSCDESSNDSWSVASSSVLSSPSSPEPLFKKSRVQDPQMTLPMPSLNLNRVIVGSPS

ccccccccccccccccccccccccccccccccccHHcccccccccHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccEEEEcccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccc

***********FLLDALYCEEEEL*************QNKNPACLFSLLLLEQDLFWEDEELLSLFSKEEQ*LL***TQTHYKDSDVLVVARSEAVEWVLKVNAHYGFSTLTAILAINYLDRFLRSFHFQIDKPWMIQLLAVTCLSLAAKVEETQVPLLLDLQVEGAKYVFETKAIQRMELLVLSTLEWKMHPVTPISFLDHIIRRLGLKTSLHWEFLKRCERLLLTLVSDSRSVSYLPSVLATATMMHIIDQVEPVNPVDYQNQLLGVLKISKEKVSDCYKLILELAN**********************GVIDATVF*******************************************SLNLNRVIVGSP*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAFGDEQYPSSFLxxxxxxxxxxxxxxxxxxxxxECSQNKNPACLFSLLLLEQDLFWEDEELLSLFSKEEQQLLKQETQTHYKDSDVLVVARSEAVEWVLKVNAHYGFSTLTAILAINYLDRFLRSFHFQIDKPWMIQLLAVTCLSLAAKVEETQVPLLLDLQVEGAKYVFETKAIQRMELLVLSTLEWKMHPVTPISFLDHIIRRLGLKTSLHWEFLKRCERLLLTLVSDSRSVSYLPSVLATATMMHIIDQVEPVNPVDYQNQLLGVLKISKEKVSDCYKLILELANAKTNANSNPHKRKFEAIPGSPGGVIDATVFSCDESSNDSWSVASSSVLSSPSSPEPLFKKSRVQDPQMTLPMPSLNLNRVIVGSPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cyclin-D3-1	Involved in the control of the cell cycle at the G1/S (start) transition. Activates the G1/S phase transition in response to cytokinin hormone signal, but declines in response to sucrose starvation leading to G1 arrest. Involved in the induction of mitotic cell division. Plays an important role in the switch from cell proliferation to the final stages of differentiation during plant development. May not be involved in the activation of cell cycle in the root apical meristem (RAM) in the early phase of seed germination.	probable	P42753

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G33, chain B
Confidence level:very confident
Coverage over the Query: 57-291
View the alignment between query and template
View the model in PyMOL