BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 017292
         (374 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3GK8|L Chain L, X-Ray Crystal Structure Of The Fab From Mab 14, Mouse
           Antibody Against Canine Parvovirus
          Length = 214

 Score = 27.7 bits (60), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 11  SSRVCFLGNVL-NDLQNSWAVEGSKTGGKGLKSISNE 46
           +S VCFL N    D+   WA++G++  G  L S + +
Sbjct: 130 ASVVCFLNNFYPKDINVKWAIDGAERAGGVLNSFTGQ 166


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.135    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,790,850
Number of Sequences: 62578
Number of extensions: 438946
Number of successful extensions: 807
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 805
Number of HSP's gapped (non-prelim): 6
length of query: 374
length of database: 14,973,337
effective HSP length: 100
effective length of query: 274
effective length of database: 8,715,537
effective search space: 2388057138
effective search space used: 2388057138
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)