BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 017298
(374 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2YOO|A Chain A, Cholest-4-en-3-one Bound Structure Of Cyp142 From
Mycobacterium Smegmatis
pdb|2YOO|B Chain B, Cholest-4-en-3-one Bound Structure Of Cyp142 From
Mycobacterium Smegmatis
pdb|2YOO|C Chain C, Cholest-4-en-3-one Bound Structure Of Cyp142 From
Mycobacterium Smegmatis
pdb|2YOO|D Chain D, Cholest-4-en-3-one Bound Structure Of Cyp142 From
Mycobacterium Smegmatis
pdb|3ZBY|A Chain A, Ligand-free Structure Of Cyp142 From Mycobacterium
Smegmatis
pdb|3ZBY|B Chain B, Ligand-free Structure Of Cyp142 From Mycobacterium
Smegmatis
pdb|3ZBY|C Chain C, Ligand-free Structure Of Cyp142 From Mycobacterium
Smegmatis
pdb|3ZBY|D Chain D, Ligand-free Structure Of Cyp142 From Mycobacterium
Smegmatis
pdb|3ZBY|E Chain E, Ligand-free Structure Of Cyp142 From Mycobacterium
Smegmatis
pdb|3ZBY|F Chain F, Ligand-free Structure Of Cyp142 From Mycobacterium
Smegmatis
Length = 407
Score = 34.3 bits (77), Expect = 0.13, Method: Compositional matrix adjust.
Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
Query: 218 DLFPFRLGNMMSYDKQLANMCTLFTFQS-FRKLLLQEGEKLVLVWLDTPYNQAVYGLVDK 276
DL P + M+ + + NMC T + F L+ GEK++L++ ++++V+G D
Sbjct: 264 DLLPGAIEEMLRWTSPVKNMCRTLTADTVFHGTELRAGEKIMLMFESANFDESVFGDPDN 323
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.139 0.422
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,186,792
Number of Sequences: 62578
Number of extensions: 317140
Number of successful extensions: 661
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 660
Number of HSP's gapped (non-prelim): 1
length of query: 374
length of database: 14,973,337
effective HSP length: 100
effective length of query: 274
effective length of database: 8,715,537
effective search space: 2388057138
effective search space used: 2388057138
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)