BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 017370
         (372 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate
           Carboxylase
 pdb|4HNU|B Chain B, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate
           Carboxylase
 pdb|4HNU|C Chain C, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate
           Carboxylase
 pdb|4HNU|D Chain D, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate
           Carboxylase
          Length = 1173

 Score = 27.7 bits (60), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 122 SITGVDSMGGFHPSLDAIVEGLGYAAPPIMALLFILDDEVVKLSPHARAIRDVEDEELRS 181
           +I    S GGF   LDA   G G+    I       D  +VKLS HA + +  E+E +RS
Sbjct: 385 TIIAYRSSGGFGVRLDA---GDGFQGAEISPYY---DSLLVKLSTHAISFKQAEEEMVRS 438

Query: 182 F 182
            
Sbjct: 439 L 439


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.138    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,141,976
Number of Sequences: 62578
Number of extensions: 334497
Number of successful extensions: 632
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 632
Number of HSP's gapped (non-prelim): 2
length of query: 372
length of database: 14,973,337
effective HSP length: 100
effective length of query: 272
effective length of database: 8,715,537
effective search space: 2370626064
effective search space used: 2370626064
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)