BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 017396
         (372 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2ZIH|A Chain A, Crystal Structure Of Yeast Vps74
 pdb|2ZIH|B Chain B, Crystal Structure Of Yeast Vps74
 pdb|2ZIH|C Chain C, Crystal Structure Of Yeast Vps74
 pdb|2ZIH|D Chain D, Crystal Structure Of Yeast Vps74
          Length = 347

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 57  SSQTKNVNGNRGDQVNKSVKGADDKNGINKNNTFHPLGSKNADNV 101
           SS   + N  +GD++       DD NG NK   + P  SK  DN+
Sbjct: 20  SSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRDNI 64


>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex
           With Adp
          Length = 330

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query: 138 EDSGKSRKEGTRVEECHSSNKCMDEKMQFVACLR-----VPGNDSPDLSLLIQNKVKG 190
           E  GKS  EG+R+ E    NK +      +A LR     VP  +S  L+ L+Q+ + G
Sbjct: 239 ERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNS-KLTYLLQDSLSG 295


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.309    0.128    0.357 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,823,676
Number of Sequences: 62578
Number of extensions: 413011
Number of successful extensions: 682
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 13
Number of HSP's that attempted gapping in prelim test: 681
Number of HSP's gapped (non-prelim): 17
length of query: 372
length of database: 14,973,337
effective HSP length: 100
effective length of query: 272
effective length of database: 8,715,537
effective search space: 2370626064
effective search space used: 2370626064
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 52 (24.6 bits)