Citrus Sinensis ID: 017397


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370--
MQLFGLVNTLLENSRNTSEKDLSIQRYSVIPLSPNSGLIEWVPNCDTLHYLIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFNEVPQMSVFANTHVPPVVNAEETAPNRELPQPQRGARERELLQAVNQLGDASEVLNGRAVVVMARMSNKLTGRDFSSTPLPTSSIQQAVDHSTLISGDSREVDHGLSVKLQVQKLIIQATSHENLCQNYVGWCPFW
ccHHHHHHHHHcccccccccccccEEEccEEccccccEEECccccHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEccccccEEEEEcccHHHHHcccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHcccccccc
MQLFGLVNTLLENSRNTSEKDLSIQRYSVIPLSPNSGLIEWVPNCDTLHYLIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNF*********************************************NQLGDASEVLNGRAVVVMARMSNKLTGRDFSSTPLP********************VDHGLSVKLQVQKLIIQATSHENLCQNYVGWCPFW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLFGLVNTLLENSRNTSEKDLSIQRYSVIPLSPNSGLIEWVPNCDTLHYLIREYRDARKITLNQEHKYMLSFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEIWLERRTNYTRSLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRSNRDSVMAMMEAFVHDPLINWRLFNFNEVPQMSVFANTHVPPVVNAEETAPNRELPQPQRGARERELLQAVNQLGDASEVLNGRAVVVMARMSNKLTGRDFSSTPLPTSSIQQAVDHSTLISGDSREVDHGLSVKLQVQKLIIQATSHENLCQNYVGWCPFW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase TOR Essential cell growth regulator that controls plant development. Acts through the phosphorylation of downstream effectors that are recruited by the binding partner RAPTOR. Acts by activating transcription, protein synthesis and ribosome biogenesis, and inhibiting mRNA degradation and autophagy.probableQ0DJS1
Serine/threonine-protein kinase TOR Essential cell growth regulator that controls development from early embryo to seed production. Controls plant growth in environmental stress conditions. Acts through the phosphorylation of downstream effectors that are recruited by the binding partner RAPTOR. Acts by activating transcription, protein synthesis and ribosome biogenesis, and inhibiting mRNA degradation and autophagy.probableQ9FR53

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WXF, chain A
Confidence level:very confident
Coverage over the Query: 1-61,72-77,97-233
View the alignment between query and template
View the model in PyMOL
Template: 1W1N, chain A
Confidence level:very confident
Coverage over the Query: 341-372
View the alignment between query and template
View the model in PyMOL
Template: 2X6F, chain A
Confidence level:probable
Coverage over the Query: 2-90,121-224
View the alignment between query and template
View the model in PyMOL