BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 017437
         (371 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1LLW|A Chain A, Structural Studies On The Synchronization Of Catalytic
           Centers In Glutamate Synthase: Complex With
           2-Oxoglutarate
 pdb|1LLZ|A Chain A, Structural Studies On The Synchronization Of Catalytic
           Centers In Glutamate Synthase: Reduced Enzyme
 pdb|1LM1|A Chain A, Structural Studies On The Synchronization Of Catalytic
           Centers In Glutamate Synthase: Native Enzyme
 pdb|1OFD|A Chain A, Glutamate Synthase From Synechocystis Sp In Complex With
           2-Oxoglutarate At 2.0 Angstrom Resolution
 pdb|1OFD|B Chain B, Glutamate Synthase From Synechocystis Sp In Complex With
           2-Oxoglutarate At 2.0 Angstrom Resolution
 pdb|1OFE|A Chain A, Glutamate Synthase From Synechocystis Sp In Complex With
           2-Oxoglutarate And L-Don At 2.45 Angstrom Resolution
 pdb|1OFE|B Chain B, Glutamate Synthase From Synechocystis Sp In Complex With
           2-Oxoglutarate And L-Don At 2.45 Angstrom Resolution
          Length = 1520

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%)

Query: 4   AETESERRRVIVRNILSKEECEELELIHKSCSTVGYRPNVFSTTLS 49
           A  E +RR  I R+I+ K+  E+  +   SC T+ Y+  V S  L 
Sbjct: 140 AGDELDRRLYIARSIIGKKLAEDFYVCSFSCRTIVYKGMVRSIILG 185


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.132    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,642,268
Number of Sequences: 62578
Number of extensions: 421876
Number of successful extensions: 1029
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1028
Number of HSP's gapped (non-prelim): 8
length of query: 371
length of database: 14,973,337
effective HSP length: 100
effective length of query: 271
effective length of database: 8,715,537
effective search space: 2361910527
effective search space used: 2361910527
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)