BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 017437
(371 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1LLW|A Chain A, Structural Studies On The Synchronization Of Catalytic
Centers In Glutamate Synthase: Complex With
2-Oxoglutarate
pdb|1LLZ|A Chain A, Structural Studies On The Synchronization Of Catalytic
Centers In Glutamate Synthase: Reduced Enzyme
pdb|1LM1|A Chain A, Structural Studies On The Synchronization Of Catalytic
Centers In Glutamate Synthase: Native Enzyme
pdb|1OFD|A Chain A, Glutamate Synthase From Synechocystis Sp In Complex With
2-Oxoglutarate At 2.0 Angstrom Resolution
pdb|1OFD|B Chain B, Glutamate Synthase From Synechocystis Sp In Complex With
2-Oxoglutarate At 2.0 Angstrom Resolution
pdb|1OFE|A Chain A, Glutamate Synthase From Synechocystis Sp In Complex With
2-Oxoglutarate And L-Don At 2.45 Angstrom Resolution
pdb|1OFE|B Chain B, Glutamate Synthase From Synechocystis Sp In Complex With
2-Oxoglutarate And L-Don At 2.45 Angstrom Resolution
Length = 1520
Score = 29.6 bits (65), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 16/46 (34%), Positives = 24/46 (52%)
Query: 4 AETESERRRVIVRNILSKEECEELELIHKSCSTVGYRPNVFSTTLS 49
A E +RR I R+I+ K+ E+ + SC T+ Y+ V S L
Sbjct: 140 AGDELDRRLYIARSIIGKKLAEDFYVCSFSCRTIVYKGMVRSIILG 185
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.132 0.405
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,642,268
Number of Sequences: 62578
Number of extensions: 421876
Number of successful extensions: 1029
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1028
Number of HSP's gapped (non-prelim): 8
length of query: 371
length of database: 14,973,337
effective HSP length: 100
effective length of query: 271
effective length of database: 8,715,537
effective search space: 2361910527
effective search space used: 2361910527
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)