Citrus Sinensis ID: 017445


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-
MAGLEELKKKLAPLFDAEKGFSAGSTLDPSDSYMLSDGGTVNLLSRSYGVYNFNELGLQKCTSWLADESDHSEKTYRCASHEMRIFGAIGSGASSVVQRAVHIPTHRIIALKKINIFEKEKRNQLLTEIRTLCEAPCNEGLVEFHGAFYMPDSGQISIALEYMDGGSLADILRMQKSIPEPILSSMFKKLLQGLSYLHGVRHLVHRDIKPANLLVNLKGRPKITDFGISAGLENSIAMCATFVGTVTYMSPERIRNESYSYPADIWSIGLALFECGTGEFPYAASEGPVNLMLQILEDPSPSPSRQNFSPEFCSFVDDCLKKDAEARPTADQLLSHPFITKYEHAKVDLAAFVRSVFDPMQRMKDLADVST
cccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccHHHcccccccccEEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHHHccccccccEEEEEEEECccccEEEEEEEccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccHHHHHcccHHHccccccccHHHHHHHHcccHHHHHHHccccc
**************************************************************************TYRCASHEMRIFGAIGSGASSVVQRAVHIPTHRIIALKKINIFEKEKRNQLLTEIRTLCEAPCNEGLVEFHGAFYMPDSGQISIALEYMDGGSLADILRMQKSIPEPILSSMFKKLLQGLSYLHGVRHLVHRDIKPANLLVNLKGRPKITDFGISAGLENSIAMCATFVGTVTYMSPERIRNESYSYPADIWSIGLALFECGTGEFPYAASEGPVNLMLQILEDPSP*****NFSPEFCSFVDDCLKKDAEARPTADQLLSHPFITKYEHAKVDLAAFVRSVFD*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGLEELKKKLAPLFDAEKGFSAGSTLDPSDSYMLSDGGTVNLLSRSYGVYNFNELGLQKCTSWLADESDHSEKTYRCASHEMRIFGAIGSGASSVVQRAVHIPTHRIIALKKINIFEKEKRNQLLTEIRTLCEAPCNEGLVEFHGAFYMPDSGQISIALEYMDGGSLADILRMQKSIPEPILSSMFKKLLQGLSYLHGVRHLVHRDIKPANLLVNLKGRPKITDFGISAGLENSIAMCATFVGTVTYMSPERIRNESYSYPADIWSIGLALFECGTGEFPYAASEGPVNLMLQILEDPSPSPSRQNFSPEFCSFVDDCLKKDAEARPTADQLLSHPFITKYEHAKVDLAAFVRSVFDPMQRMKDLADVST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein kinase byr1 Serine/threonine protein kinase involved in conjugation and sporulation. It is thought that it is phosphorylated by the byr2 protein kinase and that it can phosphorylate the spk1 kinase. When bound to bob1, is involved in the regulation of sexual differentiation.probableP10506
Mitogen-activated protein kinase kinase 1 probableQ5QN75

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.12.-Dual-specificity kinases (those acting on Ser/Thr and Tyr residues).probable
2.7.12.2Mitogen-activated protein kinase kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I6U, chain A
Confidence level:very confident
Coverage over the Query: 24-61,73-233,246-343
View the alignment between query and template
View the model in PyMOL
Template: 3GGF, chain A
Confidence level:confident
Coverage over the Query: 89-364
View the alignment between query and template
View the model in PyMOL