Citrus Sinensis ID: 017458


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-
MKLDVDVLRYLSKDDFRVLTAVEMGMRNHEIVPSELVHRIASLKHGGTYKVLKNLLRYKLLHHDSSKYDGFRLTYLGYDFLAIKTLVNRGVFTAVGRQLGVGKESDIFEVAREDGTVLAMKLHRLGRTSFRAVKSKRDYLRHRNSYNWLYLSRLAALKEFAFMKALEDHGFPVPNAVDCNRHCVIMSLVQGYPLVQVNQLQNPDSVFETIIGLVVRLAEHGLIHCDFNEFNIMIDDDEKVTMIDFPQMVSVSHQNAQMYFDRDVECIFKFFRKRFHLNFQETTDGDDGSDIDTDEGSRLSFASISKTAGFLDKELAASGFTRKDQDVIQKFIGGSIEESGSDDEGSDDGNESETNETNVDGLDSLHLAEQI
ccccHHHHcccccccHHHHHHHHHcccccccccHHHHHHHHccccccHHHHHHHHHHcccccccccccccEEEECcHHHHHHHHHHHHcccccccccccccccccCEEEEEcccccEEEEEEEEcccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccCEECcccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccEEccccccEEEECccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHcccccccHHHHHcccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHcccc
MKLDVDVLRYLSKDDFRVLTAVEMGMRNHEIVPSELVHRIASLKHGGTYKVLKNLLRYKLLHHDSSKYDGFRLTYLGYDFLAIKTLVNRGVFTAVGRQLGVGKESDIFEVAREDGTVLAMKLHRLGRTSFRAVKSKRDYLRHRNSYNWLYLSRLAALKEFAFMKALEDHGFPVPNAVDCNRHCVIMSLVQGYPLVQVNQLQNPDSVFETIIGLVVRLAEHGLIHCDFNEFNIMIDDDEKVTMIDFPQMVSVSHQNAQMYFDRDVECIFKFFRKRFHLNFQETTDGDDGSDIDTDEGSRLSF*S****AGFLDKELAASGFTRK**DVIQKFI***************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLDVDVLRYLSKDDFRVLTAVEMGMRNHEIVPSELVHRIASLKHGGTYKVLKNLLRYKLLHHDSSKYDGFRLTYLGYDFLAIKTLVNRGVFTAVGRQLGVGKESDIFEVAREDGTVLAMKLHRLGRTSFRAVKSKRDYLRHRNSYNWLYLSRLAALKEFAFMKALEDHGFPVPNAVDCNRHCVIMSLVQGYPLVQVNQLQNPDSVFETIIGLVVRLAEHGLIHCDFNEFNIMIDDDEKVTMIDFPQMVSVSHQNAQMYFDRDVECIFKFFRKRFHLNFQETTDGDDGSDIDTDEGSRLSFASISKTAGFLDKELAASGFTRKDQDVIQKFIGGSIEESGSDDEGSDDGNESETNETNVDGLDSLHLAEQI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase rio2 Required for the final endonucleolytic cleavage of 20S pre-rRNA at site D in the cytoplasm, converting it into the mature 18S rRNA. Involved in normal export of the pre-40S particles from the nucleus to the cytoplasm.probableQ9P7W5
Serine/threonine-protein kinase RIO2 Required for the final endonucleolytic cleavage of 20S pre-rRNA at site D in the cytoplasm, converting it into the mature 18S rRNA. Involved in normal export of the pre-40S particles from the nucleus to the cytoplasm.probableP40160

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GYI, chain A
Confidence level:very confident
Coverage over the Query: 2-334
View the alignment between query and template
View the model in PyMOL
Template: 2ACX, chain A
Confidence level:confident
Coverage over the Query: 28-132,143-258,269-369
View the alignment between query and template
View the model in PyMOL