BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 017464
         (371 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1IRZ|A Chain A, Solution Structure Of Arr10-B Belonging To The Garp Family
           Of Plant Myb-Related Dna Binding Motifs Of The
           Arabidopsis Response Regulators
          Length = 64

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (1%)

Query: 64  KMPRLRWTPDLHLRFVNAVEKLGGQERATPKLVLQMMDIKGLSIAHVKSHLQMYR 118
           K PR+ WT +LH +F+ AV+ LG  ERA PK +L +M++  L+  +V SHLQ +R
Sbjct: 4   KKPRVLWTHELHNKFLAAVDHLG-VERAVPKKILDLMNVDKLTRENVASHLQKFR 57


>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase, Type I From Burkholderia Pseudomallei
 pdb|3GNQ|B Chain B, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase, Type I From Burkholderia Pseudomallei
 pdb|3GNQ|C Chain C, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase, Type I From Burkholderia Pseudomallei
 pdb|3GNQ|D Chain D, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase, Type I From Burkholderia Pseudomallei
 pdb|3GNQ|E Chain E, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase, Type I From Burkholderia Pseudomallei
 pdb|3GNQ|F Chain F, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase, Type I From Burkholderia Pseudomallei
 pdb|3GNQ|G Chain G, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase, Type I From Burkholderia Pseudomallei
 pdb|3GNQ|H Chain H, Crystal Structure Of Glyceraldehyde-3-Phosphate
           Dehydrogenase, Type I From Burkholderia Pseudomallei
          Length = 344

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%)

Query: 97  LQMMDIKGLSIAHVKSHLQMYRSKKIDDPGRAMADHRHLVESGDR 141
           L+++ I  L  A   +HL  Y +     PG    D  +LV +GDR
Sbjct: 38  LEIVAINDLGDAKTNAHLTQYDTAHGKFPGEVSVDGDYLVVNGDR 82


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.128    0.372 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,865,531
Number of Sequences: 62578
Number of extensions: 363308
Number of successful extensions: 584
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 581
Number of HSP's gapped (non-prelim): 2
length of query: 371
length of database: 14,973,337
effective HSP length: 100
effective length of query: 271
effective length of database: 8,715,537
effective search space: 2361910527
effective search space used: 2361910527
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 52 (24.6 bits)