BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 017464
(371 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1IRZ|A Chain A, Solution Structure Of Arr10-B Belonging To The Garp Family
Of Plant Myb-Related Dna Binding Motifs Of The
Arabidopsis Response Regulators
Length = 64
Score = 51.6 bits (122), Expect = 7e-07, Method: Composition-based stats.
Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (1%)
Query: 64 KMPRLRWTPDLHLRFVNAVEKLGGQERATPKLVLQMMDIKGLSIAHVKSHLQMYR 118
K PR+ WT +LH +F+ AV+ LG ERA PK +L +M++ L+ +V SHLQ +R
Sbjct: 4 KKPRVLWTHELHNKFLAAVDHLG-VERAVPKKILDLMNVDKLTRENVASHLQKFR 57
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate
Dehydrogenase, Type I From Burkholderia Pseudomallei
pdb|3GNQ|B Chain B, Crystal Structure Of Glyceraldehyde-3-Phosphate
Dehydrogenase, Type I From Burkholderia Pseudomallei
pdb|3GNQ|C Chain C, Crystal Structure Of Glyceraldehyde-3-Phosphate
Dehydrogenase, Type I From Burkholderia Pseudomallei
pdb|3GNQ|D Chain D, Crystal Structure Of Glyceraldehyde-3-Phosphate
Dehydrogenase, Type I From Burkholderia Pseudomallei
pdb|3GNQ|E Chain E, Crystal Structure Of Glyceraldehyde-3-Phosphate
Dehydrogenase, Type I From Burkholderia Pseudomallei
pdb|3GNQ|F Chain F, Crystal Structure Of Glyceraldehyde-3-Phosphate
Dehydrogenase, Type I From Burkholderia Pseudomallei
pdb|3GNQ|G Chain G, Crystal Structure Of Glyceraldehyde-3-Phosphate
Dehydrogenase, Type I From Burkholderia Pseudomallei
pdb|3GNQ|H Chain H, Crystal Structure Of Glyceraldehyde-3-Phosphate
Dehydrogenase, Type I From Burkholderia Pseudomallei
Length = 344
Score = 29.3 bits (64), Expect = 3.5, Method: Compositional matrix adjust.
Identities = 15/45 (33%), Positives = 22/45 (48%)
Query: 97 LQMMDIKGLSIAHVKSHLQMYRSKKIDDPGRAMADHRHLVESGDR 141
L+++ I L A +HL Y + PG D +LV +GDR
Sbjct: 38 LEIVAINDLGDAKTNAHLTQYDTAHGKFPGEVSVDGDYLVVNGDR 82
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.128 0.372
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,865,531
Number of Sequences: 62578
Number of extensions: 363308
Number of successful extensions: 584
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 581
Number of HSP's gapped (non-prelim): 2
length of query: 371
length of database: 14,973,337
effective HSP length: 100
effective length of query: 271
effective length of database: 8,715,537
effective search space: 2361910527
effective search space used: 2361910527
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 52 (24.6 bits)