Query         017473
Match_columns 371
No_of_seqs    173 out of 906
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 08:52:48 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/017473.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/017473hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 1.6E-39 3.5E-44  277.3   7.2  124    5-132     1-129 (129)
  2 COG4868 Uncharacterized protei  33.8      16 0.00034   38.0   0.4   16  334-349   210-225 (493)
  3 smart00265 BH4 BH4 Bcl-2 homol  19.5 1.2E+02  0.0026   20.5   2.4   18   15-32      6-23  (27)
  4 PF03540 TFIID_30kDa:  Transcri  16.3      99  0.0021   23.6   1.7   13   13-25      1-15  (51)
  5 PHA00692 hypothetical protein   16.2      60  0.0013   25.9   0.5    8    5-12     37-44  (74)
  6 PF08999 SP_C-Propep:  Surfacta  14.5      66  0.0014   27.1   0.4   25  262-286     3-31  (93)
  7 PRK13663 hypothetical protein;  13.2      70  0.0015   34.2   0.2   16  334-349   210-225 (493)
  8 PF12593 McyA_C:  Microcystin s  13.2      94   0.002   22.7   0.8   23  317-344    15-37  (40)
  9 PF08338 DUF1731:  Domain of un  12.3 1.3E+02  0.0029   22.1   1.4   15    7-21     31-47  (48)
 10 smart00707 RPEL Repeat in Dros  11.7      75  0.0016   21.2  -0.1   13    7-19      5-18  (26)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=1.6e-39  Score=277.27  Aligned_cols=124  Identities=32%  Similarity=0.600  Sum_probs=92.1

Q ss_pred             CCCCceECCc-HHHHHHHHhhhhcCCCCCC-CCccccCCccCCCCCCccccCCCCCCCceEEEee-ccC-CCCCCCCccc
Q 017473            5 MREWYKSQPS-DELILCLLKKKRLDPHFSY-GPIKDIGHICSLEPWDLATESETDSEDQTCYFFY-KPR-YTKSNDAHRA   80 (371)
Q Consensus         5 LPPGfRF~PT-EELV~~YLr~KI~G~plp~-~vI~ev~DVY~~ePWdL~~~~pGk~~d~eWYFFS-R~r-y~~G~R~nRa   80 (371)
                      |||||||+|| +|||.+||++|+.|.+++. ++|.++ |||++|||+|+..  ....+++||||+ +.+ +.+|.|.+|+
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~-Diy~~~P~~L~~~--~~~~~~~~yFF~~~~~~~~~~~r~~R~   77 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDV-DIYSAHPWELPAK--FKGGDEEWYFFSPRKKKYPNGGRPNRV   77 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE---GGGS-GGGCHHH--SSS-SSEEEEEEE----------S-EE
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeec-ccCccChHHhhhh--ccCCCceEEEEEecccccCCccccccc
Confidence            8999999999 9999999999999999887 899999 9999999999732  233577999999 655 7789999999


Q ss_pred             CCCceeeeeCCceeEee-CCceEEEEEEEeeeccCCCCCCCCcCeEEEEEEeC
Q 017473           81 TNAGSWKVTRKVSQIEA-RNGLTGTKKSLTFYLRGLPRKEAITEWGMHEYHVK  132 (371)
Q Consensus        81 tg~G~WKatG~dK~I~~-~g~vVG~KKtLvFY~gr~~r~p~KT~WvMhEYrL~  132 (371)
                      +++|+||++|++++|.+ +|.+||+|++|+||.++.+ .+.+|+|+||||+|.
T Consensus        78 ~~~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~~-~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   78 TGGGYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKSP-NGKKTGWVMHEYSLE  129 (129)
T ss_dssp             ETTEEEEEECEEEEEEE-TTCEEEEEEEEEEEESSTT-S-EEEEEEEEEEEE-
T ss_pred             ccceEEeecccccccccccceeeeeEEEEEEEeccCC-CCCcCCeEEEEEEeC
Confidence            99999999999999999 8999999999999987521 344999999999984


No 2  
>COG4868 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.80  E-value=16  Score=37.96  Aligned_cols=16  Identities=50%  Similarity=1.126  Sum_probs=13.0

Q ss_pred             ccccccCCcccccccC
Q 017473          334 EWQLPLHHPLEIHNSA  349 (371)
Q Consensus       334 ~~~~~~~~~~~~~~~~  349 (371)
                      -|.||||||+.+--.|
T Consensus       210 vWNlPL~HPvNlAYEA  225 (493)
T COG4868         210 VWNLPLHHPVNLAYEA  225 (493)
T ss_pred             ccccccCCchhhhhhh
Confidence            5999999999876544


No 3  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=19.49  E-value=1.2e+02  Score=20.47  Aligned_cols=18  Identities=17%  Similarity=0.217  Sum_probs=14.9

Q ss_pred             HHHHHHHHhhhhcCCCCC
Q 017473           15 DELILCLLKKKRLDPHFS   32 (371)
Q Consensus        15 EELV~~YLr~KI~G~plp   32 (371)
                      .|||.+|+.-|+.-...+
T Consensus         6 RelV~~yv~yKLsQrgy~   23 (27)
T smart00265        6 RELVVDYVTYKLSQNGYE   23 (27)
T ss_pred             HHHHHHHHHHHHhhcCCC
Confidence            899999999999766443


No 4  
>PF03540 TFIID_30kDa:  Transcription initiation factor TFIID 23-30kDa subunit;  InterPro: IPR003923 Transcription initiation factor TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. The complex includes TATA binding protein (TBP) and various TBP-associated factors (TAFS). TFIID a bona fide RNA polymerase II-specific TATA-binding protein-associated factor (TAF) and is essential for viability []. TFIID acts to nucleate the transcription complex, recruiting the rest of the factors through a direct interaction with TFIIB. The TBP subunit of TFIID is sufficient for TATA-element binding and TFIIB interaction, and can support basal transcription. The protein belongs to the TAF2H family.; GO: 0006352 transcription initiation, DNA-dependent, 0005634 nucleus
Probab=16.32  E-value=99  Score=23.63  Aligned_cols=13  Identities=31%  Similarity=0.567  Sum_probs=10.9

Q ss_pred             Cc--HHHHHHHHhhh
Q 017473           13 PS--DELILCLLKKK   25 (371)
Q Consensus        13 PT--EELV~~YLr~K   25 (371)
                      ||  +||+.|||.+-
T Consensus         1 P~IPD~v~~~yL~~~   15 (51)
T PF03540_consen    1 PTIPDEVTDYYLERS   15 (51)
T ss_pred             CCCCHHHHHHHHHHC
Confidence            77  99999999763


No 5  
>PHA00692 hypothetical protein
Probab=16.20  E-value=60  Score=25.85  Aligned_cols=8  Identities=0%  Similarity=-0.064  Sum_probs=6.8

Q ss_pred             CCCCceEC
Q 017473            5 MREWYKSQ   12 (371)
Q Consensus         5 LPPGfRF~   12 (371)
                      .||||||-
T Consensus        37 yppgfrfg   44 (74)
T PHA00692         37 YPPGFRFG   44 (74)
T ss_pred             cCCCcccc
Confidence            69999995


No 6  
>PF08999 SP_C-Propep:  Surfactant protein C, N terminal propeptide;  InterPro: IPR015091 The N-terminal propeptide of surfactant protein C adopts an alpha-helical structure, with turn and extended regions. Its main function is the stabilisation of metastable surfactant protein C (SP-C), since the latter can irreversibly transform from its native alpha-helical structure to beta-sheet aggregates and form amyloid-like fibrils. The correct intracellular trafficking of proSP-C has also been reported to depend on the propeptide []. ; PDB: 1SPF_A 2YAD_F.
Probab=14.53  E-value=66  Score=27.14  Aligned_cols=25  Identities=28%  Similarity=0.608  Sum_probs=3.3

Q ss_pred             hhhcceecccCCCCCCCcc----cCCccc
Q 017473          262 IEQNMYLLKYLPNYSPAQQ----LPCDHF  286 (371)
Q Consensus       262 ~~~~~~~~~~~~~~~~~~~----~~~~~~  286 (371)
                      +-+|.-|+.-||.||-+-+    ||||..
T Consensus         3 ~g~ke~lme~pp~ysa~p~~r~~iPc~p~   31 (93)
T PF08999_consen    3 VGSKEVLMERPPDYSAAPRGRFGIPCCPV   31 (93)
T ss_dssp             ------------------------SSS-S
T ss_pred             ccchhhhhcCCCccccCCCCccCCCcccc
Confidence            4456677888999998776    999984


No 7  
>PRK13663 hypothetical protein; Provisional
Probab=13.20  E-value=70  Score=34.20  Aligned_cols=16  Identities=44%  Similarity=1.014  Sum_probs=12.7

Q ss_pred             ccccccCCcccccccC
Q 017473          334 EWQLPLHHPLEIHNSA  349 (371)
Q Consensus       334 ~~~~~~~~~~~~~~~~  349 (371)
                      -|.|||.||+.|---|
T Consensus       210 iWNlPLkHPVNlAYEA  225 (493)
T PRK13663        210 VWNLPLKHPVNLAYEA  225 (493)
T ss_pred             ccCCcCCChHHHHHHH
Confidence            4999999999875443


No 8  
>PF12593 McyA_C:  Microcystin synthetase C terminal;  InterPro: IPR022583  This domain of unknown function is found in cyanobacteria and is approximately 40 amino acids in length. It is found in association with PF00501 from PFAM, PF00668 from PFAM, PF00550 from PFAM, and PF08242 from PFAM and contains a conserved YAN motif. This region is found in microcystin synthetase, which is one of a number of proteins involved in microcystin toxin synthesis []. Microcystins form a large family of small cyclic heptapeptides harbouring extensive modifications in amino acid residue composition and functional group chemistry. These peptide hepatotoxins contain a range of non-proteinogenic amino acids and unusual peptide bonds, and are typically N-methylated. They are synthesized on large enzyme complexes consisting of non-ribosomal peptide synthetases and polyketide synthases []. 
Probab=13.20  E-value=94  Score=22.67  Aligned_cols=23  Identities=43%  Similarity=0.927  Sum_probs=18.5

Q ss_pred             ccccCCCCCCcCCCCCcccccccCCccc
Q 017473          317 IEGFSPTNSLLPQNSNLEWQLPLHHPLE  344 (371)
Q Consensus       317 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~  344 (371)
                      .--|+||+---|     +||+=..|||.
T Consensus        15 l~~ft~T~q~kp-----dWq~YAN~PLq   37 (40)
T PF12593_consen   15 LRVFTPTHQAKP-----DWQLYANHPLQ   37 (40)
T ss_pred             eeeeccccccCc-----hhhhhcCCCCC
Confidence            346899986655     99999999985


No 9  
>PF08338 DUF1731:  Domain of unknown function (DUF1731);  InterPro: IPR013549 This domain of unknown function appears towards the C terminus of proteins of the NAD dependent epimerase/dehydratase family (IPR001509 from INTERPRO) in bacteria, eukaryotes and archaea. Many of the proteins in which it is found are involved in cell-division inhibition. ; PDB: 3OH8_A.
Probab=12.31  E-value=1.3e+02  Score=22.14  Aligned_cols=15  Identities=20%  Similarity=0.377  Sum_probs=8.1

Q ss_pred             CCceEC-Cc-HHHHHHH
Q 017473            7 EWYKSQ-PS-DELILCL   21 (371)
Q Consensus         7 PGfRF~-PT-EELV~~Y   21 (371)
                      -||+|+ |+ ++-+.+-
T Consensus        31 ~GF~F~~p~l~~AL~~l   47 (48)
T PF08338_consen   31 AGFQFRYPTLEEALRDL   47 (48)
T ss_dssp             TT---S-SSHHHHHHH-
T ss_pred             CCCcccCCCHHHHHhcc
Confidence            599998 88 7776653


No 10 
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=11.74  E-value=75  Score=21.19  Aligned_cols=13  Identities=23%  Similarity=0.325  Sum_probs=10.0

Q ss_pred             CCceECCc-HHHHH
Q 017473            7 EWYKSQPS-DELIL   19 (371)
Q Consensus         7 PGfRF~PT-EELV~   19 (371)
                      -...++|| +|||.
T Consensus         5 ~kl~~RP~~eeLv~   18 (26)
T smart00707        5 RKLSQRPTREELEE   18 (26)
T ss_pred             HHHHcCCCHHHHHH
Confidence            34568899 99986


Done!