Query         017479
Match_columns 371
No_of_seqs    185 out of 696
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 08:55:55 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/017479.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/017479hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03106 WRKY:  WRKY DNA -bindi 100.0 5.6E-31 1.2E-35  201.5   1.6   59  192-250     1-59  (60)
  2 smart00774 WRKY DNA binding do 100.0 9.1E-30   2E-34  195.2   3.9   58  192-249     1-59  (59)
  3 PF04500 FLYWCH:  FLYWCH zinc f  87.9    0.22 4.7E-06   35.9   0.7   47  193-249    13-62  (62)
  4 PF03101 FAR1:  FAR1 DNA-bindin  78.2     1.1 2.4E-05   35.1   1.2   30  221-251    60-89  (91)
  5 COG3280 TreY Maltooligosyl tre  45.0     7.7 0.00017   43.7   0.3   16  350-365    81-96  (889)
  6 KOG2675 Adenylate cyclase-asso  25.8 1.3E+02  0.0028   32.4   5.4   27  195-221   331-364 (480)
  7 PF03859 CG-1:  CG-1 domain;  I  19.7      84  0.0018   28.0   2.3   55  192-246    51-117 (118)
  8 PF12212 PAZ_siRNAbind:  Piwi/A  16.3      54  0.0012   25.0   0.3   15  349-363    20-34  (47)
  9 PLN03097 FHY3 Protein FAR-RED   16.2 1.1E+02  0.0023   35.1   2.6   34  218-252   156-189 (846)
 10 cd07691 Ig_CD3_gamma_delta Imm  11.8 2.3E+02  0.0051   23.1   2.7   27  194-221    17-53  (69)

No 1  
>PF03106 WRKY:  WRKY DNA -binding domain;  InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=99.96  E-value=5.6e-31  Score=201.48  Aligned_cols=59  Identities=71%  Similarity=1.356  Sum_probs=52.6

Q ss_pred             CCCcchhhccCcccccCCCCCccccccccCCCcccchhhhccCCCCEEEEEEecccCCC
Q 017479          192 LDDGYRWRKYGQKAVKNSPHPRSYYRCTSAGCGVKKRVERSSEDPTIVVTTYEGQHIHP  250 (371)
Q Consensus       192 ldDGY~WRKYGQK~IKgsp~pRsYYRCt~~gC~AkKqVQRs~dDp~i~~tTY~G~HtH~  250 (371)
                      ++|||+|||||||.|+|+++||+||||++.+|+|+|+|||+.+|+.+++|||+|+|||+
T Consensus         1 ~~Dgy~WRKYGqK~i~g~~~pRsYYrCt~~~C~akK~Vqr~~~d~~~~~vtY~G~H~h~   59 (60)
T PF03106_consen    1 LDDGYRWRKYGQKNIKGSPYPRSYYRCTHPGCPAKKQVQRSADDPNIVIVTYEGEHNHP   59 (60)
T ss_dssp             --SSS-EEEEEEEEETTTTCEEEEEEEECTTEEEEEEEEEETTCCCEEEEEEES--SS-
T ss_pred             CCCCCchhhccCcccCCCceeeEeeeccccChhheeeEEEecCCCCEEEEEEeeeeCCC
Confidence            58999999999999999999999999999999999999999999999999999999997


No 2  
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=99.96  E-value=9.1e-30  Score=195.19  Aligned_cols=58  Identities=67%  Similarity=1.300  Sum_probs=56.6

Q ss_pred             CCCcchhhccCcccccCCCCCcccccccc-CCCcccchhhhccCCCCEEEEEEecccCC
Q 017479          192 LDDGYRWRKYGQKAVKNSPHPRSYYRCTS-AGCGVKKRVERSSEDPTIVVTTYEGQHIH  249 (371)
Q Consensus       192 ldDGY~WRKYGQK~IKgsp~pRsYYRCt~-~gC~AkKqVQRs~dDp~i~~tTY~G~HtH  249 (371)
                      ++|||+|||||||.|+|+++||+||||++ ++|+|+|+|||+.+||.+++|||+|+|||
T Consensus         1 ~~DGy~WRKYGQK~ikgs~~pRsYYrCt~~~~C~a~K~Vq~~~~d~~~~~vtY~g~H~h   59 (59)
T smart00774        1 LDDGYQWRKYGQKVIKGSPFPRSYYRCTYSQGCPAKKQVQRSDDDPSVVEVTYEGEHTH   59 (59)
T ss_pred             CCCcccccccCcEecCCCcCcceEEeccccCCCCCcccEEEECCCCCEEEEEEeeEeCC
Confidence            47999999999999999999999999999 99999999999999999999999999998


No 3  
>PF04500 FLYWCH:  FLYWCH zinc finger domain;  InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a potential FLYWCH Zn-finger domain found in a number of eukaryotic proteins. FLYWCH is a C2H2-type zinc finger characterised by five conserved hydrophobic residues, containing the conserved sequence motif:  F/Y-X(n)-L-X(n)-F/Y-X(n)-WXCX(6-12)CX(17-22)HXH  where X indicates any amino acid. This domain was first characterised in Drosophila Modifier of mdg4 proteins, Mod(mgd4), putative chromatin modulators involved in higher order chromatin domains. Mod(mdg4) proteins share a common N-terminal BTB/POZ domain, but differ in their C-terminal region, most containing C-terminal FLYWCH zinc finger motifs []. The FLYWCH domain in Mod(mdg4) proteins has a putative role in protein-protein interactions; for example, Mod(mdg4)-67.2 interacts with DNA-binding protein Su(Hw) via its FLYWCH domain. FLYWCH domains have been described in other proteins as well, including suppressor of killer of prune, Su(Kpn), which contains 4 terminal FLYWCH zinc finger motifs in a tandem array and a C-terminal glutathione SH-transferase (GST) domain []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2RPR_A.
Probab=87.87  E-value=0.22  Score=35.95  Aligned_cols=47  Identities=30%  Similarity=0.648  Sum_probs=23.4

Q ss_pred             CCcchhhccCcccccCCCCCccccccccC---CCcccchhhhccCCCCEEEEEEecccCC
Q 017479          193 DDGYRWRKYGQKAVKNSPHPRSYYRCTSA---GCGVKKRVERSSEDPTIVVTTYEGQHIH  249 (371)
Q Consensus       193 dDGY~WRKYGQK~IKgsp~pRsYYRCt~~---gC~AkKqVQRs~dDp~i~~tTY~G~HtH  249 (371)
                      -|||.-+++...      ..+.|+||+..   +|+|+=.+.  .++ . .++...++|||
T Consensus        13 ~~Gy~y~~~~~~------~~~~~WrC~~~~~~~C~a~~~~~--~~~-~-~~~~~~~~HnH   62 (62)
T PF04500_consen   13 YDGYRYYFNKRN------DGKTYWRCSRRRSHGCRARLITD--AGD-G-RVVRTNGEHNH   62 (62)
T ss_dssp             ETTEEEEEEEE-------SS-EEEEEGGGTTS----EEEEE----T-T-EEEE-S---SS
T ss_pred             ECCeEEECcCCC------CCcEEEEeCCCCCCCCeEEEEEE--CCC-C-EEEECCCccCC
Confidence            578886665444      34589999973   899987777  222 3 33344499998


No 4  
>PF03101 FAR1:  FAR1 DNA-binding domain;  InterPro: IPR004330 Phytochrome A is the primary photoreceptor for mediating various far-red light-induced responses in higher plants. It has been found that the proteins governing this response, which include FAR-RED ELONGATED HYPOCOTYL3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1), are a pair of homologous proteins sharing significant sequence homology to mutator-like transposases. These proteins appear to be novel transcription factors, which are essential for activating the expression of FHY1 and FHL (for FHY1-like) and related genes, whose products are required for light-induced phytochrome A nuclear accumulation and subsequent light responses in plants. The FRS (FAR1 Related Sequences) family of proteins share a similar domain structure to mutator-like transposases, including an N-terminal C2H2 zinc finger domain, a central putative core transposase domain, and a C-terminal SWIM motif (named after SWI2/SNF and MuDR transposases). It seems plausible that the FRS family represent transcription factors derived from mutator-like transposases [, ].   This entry represents a domain found in FAR1 and FRS proteins. It contains a WRKY like fold and is therefore most likely a zinc binding DNA-binding domain.
Probab=78.15  E-value=1.1  Score=35.14  Aligned_cols=30  Identities=33%  Similarity=0.554  Sum_probs=26.0

Q ss_pred             CCCcccchhhhccCCCCEEEEEEecccCCCC
Q 017479          221 AGCGVKKRVERSSEDPTIVVTTYEGQHIHPS  251 (371)
Q Consensus       221 ~gC~AkKqVQRs~dDp~i~~tTY~G~HtH~~  251 (371)
                      -+|+|+=.|-+.. +....++.+..+|||+-
T Consensus        60 tgC~a~i~v~~~~-~~~w~v~~~~~~HNH~L   89 (91)
T PF03101_consen   60 TGCKARINVKRRK-DGKWRVTSFVLEHNHPL   89 (91)
T ss_pred             cCCCEEEEEEEcc-CCEEEEEECcCCcCCCC
Confidence            5999998888776 77889999999999974


No 5  
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism]
Probab=45.02  E-value=7.7  Score=43.66  Aligned_cols=16  Identities=44%  Similarity=0.679  Sum_probs=13.2

Q ss_pred             ccCcccccccccccCC
Q 017479          350 DHGLLQDIVPSQMRNE  365 (371)
Q Consensus       350 D~GLLQDivPs~m~ke  365 (371)
                      --||++||||.||.-.
T Consensus        81 GlGlI~DIVPNHMav~   96 (889)
T COG3280          81 GLGLIVDIVPNHMAVG   96 (889)
T ss_pred             CCceEEEecccchhcc
Confidence            3478999999999755


No 6  
>KOG2675 consensus Adenylate cyclase-associated protein (CAP/Srv2p) [Cytoskeleton; Signal transduction mechanisms]
Probab=25.76  E-value=1.3e+02  Score=32.40  Aligned_cols=27  Identities=33%  Similarity=0.724  Sum_probs=13.4

Q ss_pred             cchhhccCcccccCC------CCCccc-cccccC
Q 017479          195 GYRWRKYGQKAVKNS------PHPRSY-YRCTSA  221 (371)
Q Consensus       195 GY~WRKYGQK~IKgs------p~pRsY-YRCt~~  221 (371)
                      |-.||==-|-..++.      ...-.| |+|...
T Consensus       331 GkkW~VEnq~~~~~~Vi~~~e~kqsvyIykC~~s  364 (480)
T KOG2675|consen  331 GKKWRVENQENNKNLVIDDAELKQSVYIYKCSNS  364 (480)
T ss_pred             cceEEEeeecCCcceeeeeccccceEEEEeccce
Confidence            888993222222221      112235 999863


No 7  
>PF03859 CG-1:  CG-1 domain;  InterPro: IPR005559  CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein []. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin-binding domain and ankyrins [].; GO: 0005516 calmodulin binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=19.68  E-value=84  Score=28.04  Aligned_cols=55  Identities=25%  Similarity=0.369  Sum_probs=26.8

Q ss_pred             CCCcchhhc-cCcccc---------cCCCCCccccccccCCCcccchhhhccCCC--CEEEEEEecc
Q 017479          192 LDDGYRWRK-YGQKAV---------KNSPHPRSYYRCTSAGCGVKKRVERSSEDP--TIVVTTYEGQ  246 (371)
Q Consensus       192 ldDGY~WRK-YGQK~I---------Kgsp~pRsYYRCt~~gC~AkKqVQRs~dDp--~i~~tTY~G~  246 (371)
                      -.|||.||| =+-|.|         .|....-+||-=+..+=....+.=+..+.+  .|+.|.|...
T Consensus        51 RkDG~~WrKkkdgktvRE~HekLKv~~~e~l~~~Yah~~~~~~F~RR~Ywll~~~~~~iVLVHY~~v  117 (118)
T PF03859_consen   51 RKDGHNWRKKKDGKTVREDHEKLKVGGVEVLNCYYAHSEDNPTFHRRCYWLLDPPYEHIVLVHYLDV  117 (118)
T ss_pred             hcccceeEEcCCCCchhhhhhhhccCceeeeEEEEEeeccCCCeeeEEEEccCCCCceEEEEEeeec
Confidence            379999995 233333         233333355543322222333333334333  5788877643


No 8  
>PF12212 PAZ_siRNAbind:  Piwi/Argonaute/Zwille siRNA-binding domain;  InterPro: IPR021103  This entry represents a siRNA binding repeat found in bacterial and archaeal proteins, which is approximately 50 amino acids in length. There is a conserved LKDIL sequence motif and a single completely conserved residue L that may be functionally important []. ; PDB: 1Z26_A 1Z25_A 1U04_A 3DA5_B.
Probab=16.32  E-value=54  Score=25.03  Aligned_cols=15  Identities=27%  Similarity=0.651  Sum_probs=10.9

Q ss_pred             cccCccccccccccc
Q 017479          349 HDHGLLQDIVPSQMR  363 (371)
Q Consensus       349 ~D~GLLQDivPs~m~  363 (371)
                      +.+|+|+||+-.++.
T Consensus        20 kEN~iLKDIL~~~~t   34 (47)
T PF12212_consen   20 KENGILKDILNATTT   34 (47)
T ss_dssp             TTTEEEEETTSTT--
T ss_pred             HhhcHHHHHhcccce
Confidence            578999999976653


No 9  
>PLN03097 FHY3 Protein FAR-RED ELONGATED HYPOCOTYL 3; Provisional
Probab=16.16  E-value=1.1e+02  Score=35.09  Aligned_cols=34  Identities=24%  Similarity=0.476  Sum_probs=29.1

Q ss_pred             cccCCCcccchhhhccCCCCEEEEEEecccCCCCC
Q 017479          218 CTSAGCGVKKRVERSSEDPTIVVTTYEGQHIHPSP  252 (371)
Q Consensus       218 Ct~~gC~AkKqVQRs~dDp~i~~tTY~G~HtH~~P  252 (371)
                      |+-.||+|+=.|.+. .|+.-+++-+..+|||+--
T Consensus       156 ~tRtGC~A~m~Vk~~-~~gkW~V~~fv~eHNH~L~  189 (846)
T PLN03097        156 CAKTDCKASMHVKRR-PDGKWVIHSFVKEHNHELL  189 (846)
T ss_pred             ccCCCCceEEEEEEc-CCCeEEEEEEecCCCCCCC
Confidence            777899999999874 4568899999999999864


No 10 
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=11.79  E-value=2.3e+02  Score=23.12  Aligned_cols=27  Identities=30%  Similarity=0.764  Sum_probs=18.9

Q ss_pred             CcchhhccCcccccC--------C--CCCccccccccC
Q 017479          194 DGYRWRKYGQKAVKN--------S--PHPRSYYRCTSA  221 (371)
Q Consensus       194 DGY~WRKYGQK~IKg--------s--p~pRsYYRCt~~  221 (371)
                      .-+.|-| |-..+.-        +  .-||+=|+|.-.
T Consensus        17 tsi~W~k-G~~~~~~~~~tlnLGs~~~DPRG~Y~C~~s   53 (69)
T cd07691          17 TNITWKK-GKEILEVSNTLLDLGSRINDPRGTYSCKES   53 (69)
T ss_pred             CcEEEec-CcccccccccEEeccCcccCCCcceEecCc
Confidence            4588999 7644432        2  689999998543


Done!