Citrus Sinensis ID: 017544


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MSTSNLYCSSMALLVREPQGGSCLHFVKPFSADGCLSIKNVGRIKTAALVSGEGDVISYPNNNKKYTAIETQSDTIGFGTLGAEITPKTSDFFPNDDEFDLDRPTKGFASISEAIEDIRQGKLVIVVDDEDRENEGDLIMAASLVTPEAMAFIVRHGTGIVCVSMKGEDLERLELPLMVNHKDNEEKLCTAFTVSVDAKYGTTTGVSANDRAKTVLALACRDSKPEDFNRPGHIFPLKYREGGVLKRAGHTEASVDLAVLAGLEPVAVLCEIVDDDGSMARLPKLRQFAQTENLKIISIADLIRYRRKRDRLVELAAAAPIPTMWGPFKAHCYRSLLDGIEHIAMVKVCIHLNYQALLVKFSYFCIEEH
cccccccccccccccccccccccccccccccccccEEECccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccEEEEEccccccccccHHHHcccccHHHHHHHHHHcccEEEccccHHHHHHccccccccccccccccccccEEEECccccccccccHHHHHHHHHHHHccccccccccccccccccccccccEECccccHHHHHHHHHHHcccccEEEEEEEccccccccHHHHHHHHHHccccEEEHHHHHHHHHHccccEEEEEEEccccccccEEEEEEEEcccccEEEEEEcEEccccccEEEEEEcccccccc
*****LYCSSMALLVREPQGGSCLHFVKPFSADGCLSIKNVGRIKTAALVSGEGDVISYPN******************TLGAEITPKTSDFFP****FDL***TKGFASISEAIEDIRQGKLVIVVDDEDRENEGDLIMAASLVTPEAMAFIVRHGTGIVCVSMKGEDLERLELPLMVNHKDNEEKLCTAFTVSVDAKYGTTTGVSANDRAKTVLALACRDSKPEDFNRPGHIFPLKYREGGVLKRAGHTEASVDLAVLAGLEPVAVLCEIVDDDGSMARLPKLRQFAQTENLKIISIADLIRYRRKRDRLVELAAAAPIPTMWGPFKAHCYRSLLDGIEHIAMVKVCIHLNYQALLVKFSYFCIE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTSNLYCSSMALLVREPQGGSCLHFVKPFSADGCLSIKNVGRIKTAALVSGEGDVISYPNNNKKYTAIETQSDTIGFGTLGAEITPKTSDFFPNDDEFDLDRPTKGFASISEAIEDIRQGKLVIVVDDEDRENEGDLIMAASLVTPEAMAFIVRHGTGIVCVSMKGEDLERLELPLMVNHKDNEEKLCTAFTVSVDAKYGTTTGVSANDRAKTVLALACRDSKPEDFNRPGHIFPLKYREGGVLKRAGHTEASVDLAVLAGLEPVAVLCEIVDDDGSMARLPKLRQFAQTENLKIISIADLIRYRRKRDRLVELAAAAPIPTMWGPFKAHCYRSLLDGIEHIAMVKVCIHLNYQALLVKFSYFCIEEH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Riboflavin biosynthesis protein RibBA Catalyzes the conversion of GTP to 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate (DARP), formate and pyrophosphate.probableB0KAI2
Riboflavin biosynthesis protein RibBA Catalyzes the conversion of GTP to 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate (DARP), formate and pyrophosphate.probableB7IWM5
Riboflavin biosynthesis protein RibBA Catalyzes the conversion of GTP to 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate (DARP), formate and pyrophosphate.probableC0ZKW2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.1.-.-Carbon-carbon lyases.probable
4.1.99.-Other carbon-carbon lyases.probable
4.1.99.123,4-dihydroxy-2-butanone-4-phosphate synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G57, chain A
Confidence level:very confident
Coverage over the Query: 107-310
View the alignment between query and template
View the model in PyMOL
Template: 2BZ1, chain A
Confidence level:probable
Coverage over the Query: 313-347
View the alignment between query and template
View the model in PyMOL