BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 017556
(369 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1QH3|A Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions
Present In The Active Site
pdb|1QH3|B Chain B, Human Glyoxalase Ii With Cacodylate And Acetate Ions
Present In The Active Site
pdb|1QH5|A Chain A, Human Glyoxalase Ii With
S-(N-Hydroxy-N-Bromophenylcarbamoyl) Glutathione
pdb|1QH5|B Chain B, Human Glyoxalase Ii With
S-(N-Hydroxy-N-Bromophenylcarbamoyl) Glutathione
Length = 260
Score = 30.8 bits (68), Expect = 1.4, Method: Compositional matrix adjust.
Identities = 13/41 (31%), Positives = 22/41 (53%)
Query: 204 IFNTYHWWIHTGKSQKWDYFQVGRKIFKQMDRMEALKIALT 244
+ T+H W H G ++K + G K++ DR+ AL +T
Sbjct: 50 VLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTHKIT 90
>pdb|3LV1|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
Dehydrogenase, With Bound Nadp+
pdb|3LV1|B Chain B, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
Dehydrogenase, With Bound Nadp+
pdb|3LV1|C Chain C, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
Dehydrogenase, With Bound Nadp+
pdb|3LV1|D Chain D, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
Dehydrogenase, With Bound Nadp+
Length = 457
Score = 30.4 bits (67), Expect = 1.6, Method: Compositional matrix adjust.
Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 12/67 (17%)
Query: 231 KQMDRMEALKIALTTWAKWVGSNIDFSKTKVFFQGVAAVHVDGREWGDPTAKGCDGQTEP 290
+Q+ R+ +L + T VGS D SK + ++A VDG EW DP +E
Sbjct: 311 RQVQRLVSL-LEATQGQVLVGSQADVSK-----RALSATVVDGVEWNDPL------MSEE 358
Query: 291 MKGPKYP 297
+ GP P
Sbjct: 359 LFGPILP 365
>pdb|3LNS|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
Dehydrogenase, With Bound Nadp+ And Benzoate Adduct
pdb|3LNS|B Chain B, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
Dehydrogenase, With Bound Nadp+ And Benzoate Adduct
pdb|3LNS|C Chain C, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
Dehydrogenase, With Bound Nadp+ And Benzoate Adduct
pdb|3LNS|D Chain D, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
Dehydrogenase, With Bound Nadp+ And Benzoate Adduct
Length = 457
Score = 30.4 bits (67), Expect = 1.7, Method: Compositional matrix adjust.
Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 12/67 (17%)
Query: 231 KQMDRMEALKIALTTWAKWVGSNIDFSKTKVFFQGVAAVHVDGREWGDPTAKGCDGQTEP 290
+Q+ R+ +L + T VGS D SK + ++A VDG EW DP +E
Sbjct: 311 RQVQRLVSL-LEATQGQVLVGSQADVSK-----RALSATVVDGVEWNDPL------MSEE 358
Query: 291 MKGPKYP 297
+ GP P
Sbjct: 359 LFGPILP 365
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.139 0.463
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,551,415
Number of Sequences: 62578
Number of extensions: 559158
Number of successful extensions: 1087
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1086
Number of HSP's gapped (non-prelim): 3
length of query: 369
length of database: 14,973,337
effective HSP length: 100
effective length of query: 269
effective length of database: 8,715,537
effective search space: 2344479453
effective search space used: 2344479453
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 52 (24.6 bits)