BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 017556
         (369 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1QH3|A Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions
           Present In The Active Site
 pdb|1QH3|B Chain B, Human Glyoxalase Ii With Cacodylate And Acetate Ions
           Present In The Active Site
 pdb|1QH5|A Chain A, Human Glyoxalase Ii With
           S-(N-Hydroxy-N-Bromophenylcarbamoyl) Glutathione
 pdb|1QH5|B Chain B, Human Glyoxalase Ii With
           S-(N-Hydroxy-N-Bromophenylcarbamoyl) Glutathione
          Length = 260

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 204 IFNTYHWWIHTGKSQKWDYFQVGRKIFKQMDRMEALKIALT 244
           +  T+H W H G ++K    + G K++   DR+ AL   +T
Sbjct: 50  VLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTHKIT 90


>pdb|3LV1|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
           Dehydrogenase, With Bound Nadp+
 pdb|3LV1|B Chain B, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
           Dehydrogenase, With Bound Nadp+
 pdb|3LV1|C Chain C, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
           Dehydrogenase, With Bound Nadp+
 pdb|3LV1|D Chain D, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
           Dehydrogenase, With Bound Nadp+
          Length = 457

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 231 KQMDRMEALKIALTTWAKWVGSNIDFSKTKVFFQGVAAVHVDGREWGDPTAKGCDGQTEP 290
           +Q+ R+ +L +  T     VGS  D SK     + ++A  VDG EW DP        +E 
Sbjct: 311 RQVQRLVSL-LEATQGQVLVGSQADVSK-----RALSATVVDGVEWNDPL------MSEE 358

Query: 291 MKGPKYP 297
           + GP  P
Sbjct: 359 LFGPILP 365


>pdb|3LNS|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
           Dehydrogenase, With Bound Nadp+ And Benzoate Adduct
 pdb|3LNS|B Chain B, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
           Dehydrogenase, With Bound Nadp+ And Benzoate Adduct
 pdb|3LNS|C Chain C, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
           Dehydrogenase, With Bound Nadp+ And Benzoate Adduct
 pdb|3LNS|D Chain D, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde
           Dehydrogenase, With Bound Nadp+ And Benzoate Adduct
          Length = 457

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 231 KQMDRMEALKIALTTWAKWVGSNIDFSKTKVFFQGVAAVHVDGREWGDPTAKGCDGQTEP 290
           +Q+ R+ +L +  T     VGS  D SK     + ++A  VDG EW DP        +E 
Sbjct: 311 RQVQRLVSL-LEATQGQVLVGSQADVSK-----RALSATVVDGVEWNDPL------MSEE 358

Query: 291 MKGPKYP 297
           + GP  P
Sbjct: 359 LFGPILP 365


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.139    0.463 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,551,415
Number of Sequences: 62578
Number of extensions: 559158
Number of successful extensions: 1087
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1086
Number of HSP's gapped (non-prelim): 3
length of query: 369
length of database: 14,973,337
effective HSP length: 100
effective length of query: 269
effective length of database: 8,715,537
effective search space: 2344479453
effective search space used: 2344479453
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 52 (24.6 bits)