Citrus Sinensis ID: 017564

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MYFSKAKLKLFILFFVTSSSNLLIISINCQDDHILSLPRRQVALFIFGDSLFDAGINNYINTTTDYQANFWPYGESFFDYPTGRFSDGRLIPDFIAEYAELPFIPTFLPYHNHDQFTYGVNFASGGAGALVETHQGFVIDLETQLSYFKIVEKLLKQKLGDEEAETLLSEAVYLFGVGGNDYFNLFTSNSSDLHFSKKEFVGMEIYKRGGRKFAFANLCPLGCLPAMKVLFPGSTSPCVEDAQEFVQLHNKALSELLQELEGELKGFKYAYHDFFTSISQRFNNPSKYGFKEVTACCGSGPYGGLSSCGGKRAIKEYELCDNPNEYLFFDSSHSSEKAYKQIAELMWNGTPDVTGPYNLKMLFEHSTCI
cccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccEEEEEECccHHHccccccccccccccHHHHHHHHHHccccEEEEccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHcccccccccccHHHHHcccccc
****KAKLKLFILFFVTSSSNLLIISINCQDDHILSLPRRQVALFIFGDSLFDAGINNYINTTTDYQANFWPYGESFFDYPTGRFSDGRLIPDFIAEYAELPFIPTFLPYHNHDQFTYGVNFASGGAGALVETHQGFVIDLETQLSYFKIVEKLLKQKLGDEEAETLLSEAVYLFGVGGNDYFNLFTSNSSDLHFSKKEFVGMEIYKRGGRKFAFANLCPLGCLPAMKVLFPGSTSPCVEDAQEFVQLHNKALSELLQELEGELKGFKYAYHDFFTSISQRFNNPSKYGFKEVTACCGSGPYGGLSSCGGKRAIKEYELCDNPNEYLFFDSSHSSEKAYKQIAELMWNGTPDVTGPYNLKMLFEHS***
xxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYFSKAKLKLFILFFVTSSSNLLIISINCQDDHILSLPRRQVALFIFGDSLFDAGINNYINTTTDYQANFWPYGESFFDYPTGRFSDGRLIPDFIAEYAELPFIPTFLPYHNHDQFTYGVNFASGGAGALVETHQGFVIDLETQLSYFKIVEKLLKQKLGDEEAETLLSEAVYLFGVGGNDYFNLFTSNSSDLHFSKKEFVGMEIYKRGGRKFAFANLCPLGCLPAMKVLFPGSTSPCVEDAQEFVQLHxxxxxxxxxxxxxxxxxxxxxYHDFFTSISQRFNNPSKYGFKEVTACCGSGPYGGLSSCGGKRAIKEYELCDNPNEYLFFDSSHSSEKAYKQIAELMWNGTPDVTGPYNLKMLFEHSTCI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GDSL esterase/lipase 1 Confers resistance to the necrotrophic fungus Alternaria brassicicola. Possesses lipase and antimicrobial activities that directly disrupt fungal spore integrity. Triggers systemic resistance, mostly by the ethylene-dependent pathway.probableQ9FLN0
GDSL esterase/lipase 2 Involved in the resistance to the necrotropic bacteria Erwinia carotovora, probably via negative regulation of auxin signaling. Possesses lipase and antimicrobial activities, inhibiting germination of fungal spores (e.g. Alternaria brassicicola).probableQ9SYF0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KVN, chain X
Confidence level:very confident
Coverage over the Query: 36-365
View the alignment between query and template
View the model in PyMOL