Query         017568
Match_columns 369
No_of_seqs    86 out of 88
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 09:44:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/017568.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/017568hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0921 Dosage compensation co  76.1      15 0.00032   42.3   9.3    7  172-178  1205-1211(1282)
  2 PF08035 Op_neuropeptide:  Opio  31.0      28  0.0006   24.8   1.1   21  325-345     2-24  (31)
  3 COG3059 Predicted membrane pro  27.1      60  0.0013   30.7   2.9   24  339-365   155-178 (182)
  4 KOG3875 Peroxisomal biogenesis  20.7 2.9E+02  0.0063   28.7   6.5   16  265-280   139-154 (362)
  5 PF04224 DUF417:  Protein of un  17.7 1.2E+02  0.0026   28.5   2.9   24  338-364   151-174 (175)
  6 KOG1316 Argininosuccinate lyas  15.1      94   0.002   32.7   1.7   45  313-357   291-352 (464)
  7 TIGR02017 hutG_amidohyd N-form  14.1      87  0.0019   30.0   1.1   19   16-35    194-212 (263)
  8 PRK13896 cobyrinic acid a,c-di  12.7      92   0.002   32.2   0.9   30  333-362   104-134 (433)
  9 PF07054 Pericardin_rpt:  Peric  10.7 3.9E+02  0.0086   19.5   3.3   12  108-119    18-29  (34)
 10 PLN03021 Low-temperature-induc  10.5 2.7E+02  0.0058   30.5   3.4   59    8-76     63-147 (619)

No 1  
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]
Probab=76.10  E-value=15  Score=42.34  Aligned_cols=7  Identities=43%  Similarity=1.203  Sum_probs=3.3

Q ss_pred             CCCCCCC
Q 017568          172 ESGFGGR  178 (369)
Q Consensus       172 gsGYGgr  178 (369)
                      ++|||+.
T Consensus      1205 sGGYGgs 1211 (1282)
T KOG0921|consen 1205 SGGYGGS 1211 (1282)
T ss_pred             CCCCCCC
Confidence            3455544


No 2  
>PF08035 Op_neuropeptide:  Opioids neuropeptide;  InterPro: IPR013532 Pro-opiomelanocortin is present in high levels in the pituitary and is processed into 3 major peptide families: adrenocorticotrophin (ACTH); alpha-, beta- and gamma-melanocyte- stimulating hormones (MSH); and beta-endorphin []. ACTH regulates the synthesis and release of glucocorticoids and, to some extent, aldosterone in the adrenal cortex. It is synthesised and released in response to corticotrophin-releasing factor at times of stress (i.e. heat, cold, infection, etc.), its release leading to increased metabolism. The action of MSH in man is poorly understood, but it may be involved in temperature regulation []. Full activity of ACTH resides in the first 20 N-terminal amino acids, the first 13 of which are identical to alpha-MSH [, ]. This region corresponds to the conserved YGG motif that is found in a wide variety of opioid neuropeptides such as enkephalin
Probab=31.01  E-value=28  Score=24.76  Aligned_cols=21  Identities=29%  Similarity=0.727  Sum_probs=17.7

Q ss_pred             cccccc--cCcCCceehhhHHHH
Q 017568          325 GGLMTK--KGIRSPVVMVMRDVV  345 (369)
Q Consensus       325 ~~~~~~--~~~~~~~~~~~~~~~  345 (369)
                      ||+|+.  .-...|.|.+.|+|+
T Consensus         2 GGFM~s~~e~s~~PLvtlfkn~i   24 (31)
T PF08035_consen    2 GGFMKSWDERSHKPLVTLFKNVI   24 (31)
T ss_pred             CccccccccccCCchHHHHHHHH
Confidence            789988  666789999999985


No 3  
>COG3059 Predicted membrane protein [Function unknown]
Probab=27.07  E-value=60  Score=30.70  Aligned_cols=24  Identities=42%  Similarity=0.660  Sum_probs=20.1

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHhHhhhh
Q 017568          339 MVMRDVVMMMNIAAGLMSMAMDARRRY  365 (369)
Q Consensus       339 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  365 (369)
                      .|..|+.|+   |.+||.||-||+|-+
T Consensus       155 lvlKDilml---Agal~v~~~~a~r~l  178 (182)
T COG3059         155 LVLKDILML---AGALMVAADDANRIL  178 (182)
T ss_pred             hhHHHHHHH---HHHHHHHHhhHHHhh
Confidence            577898874   789999999999865


No 4  
>KOG3875 consensus Peroxisomal biogenesis protein peroxin [Intracellular trafficking, secretion, and vesicular transport]
Probab=20.67  E-value=2.9e+02  Score=28.70  Aligned_cols=16  Identities=25%  Similarity=0.214  Sum_probs=8.3

Q ss_pred             cccccccccccccccc
Q 017568          265 PGMAANRSMNLGMGVS  280 (369)
Q Consensus       265 ~~~~~~~~~~~~~~~~  280 (369)
                      -=||+--|.+.=++|+
T Consensus       139 T~~A~~~SFravi~Va  154 (362)
T KOG3875|consen  139 TFMAVHNSFRAVISVA  154 (362)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3455555555544544


No 5  
>PF04224 DUF417:  Protein of unknown function, DUF417;  InterPro: IPR007339 This family of uncharacterised proteins appears to be restricted to proteobacteria.
Probab=17.74  E-value=1.2e+02  Score=28.51  Aligned_cols=24  Identities=29%  Similarity=0.581  Sum_probs=20.0

Q ss_pred             ehhhHHHHHHHHHHHHHHHHHHhHhhh
Q 017568          338 VMVMRDVVMMMNIAAGLMSMAMDARRR  364 (369)
Q Consensus       338 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  364 (369)
                      -.|+.|+||+   |++|+.|+-++||-
T Consensus       151 ~fllKDivlL---a~~l~~~~~~~~r~  174 (175)
T PF04224_consen  151 RFLLKDIVLL---AASLVLLSDSAKRY  174 (175)
T ss_pred             chHHHHHHHH---HHHHHHHHHHHHhh
Confidence            4789999985   88999999888873


No 6  
>KOG1316 consensus Argininosuccinate lyase [Amino acid transport and metabolism]
Probab=15.10  E-value=94  Score=32.75  Aligned_cols=45  Identities=42%  Similarity=0.609  Sum_probs=34.2

Q ss_pred             hhccccccc--ccc----cccccccCcCC-----------ceehhhHHHHHHHHHHHHHHHH
Q 017568          313 RSMENLRGS--RVM----GGLMTKKGIRS-----------PVVMVMRDVVMMMNIAAGLMSM  357 (369)
Q Consensus       313 ~~~~~~~~~--~~~----~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~~~  357 (369)
                      .|||-|||.  ||.    |=|||-|||-|           |+.-+..-|.-++.|++|+++-
T Consensus       291 DslELlRgksgrV~gdl~g~lmt~KG~PstYnkDlQeDKep~Fds~~tv~~~l~v~tgv~st  352 (464)
T KOG1316|consen  291 DSLELLRGKSGRVFGDLTGLLMTLKGLPSTYNKDLQEDKEPLFDSSKTVSDSLQVATGVIST  352 (464)
T ss_pred             CHHHHhccccceehhhhHHHHHHhcCCccccccchhhhhhHHHhhHHHHHHHHHHHHHHhhh
Confidence            578888884  554    45789999965           6777777777889999998763


No 7  
>TIGR02017 hutG_amidohyd N-formylglutamate amidohydrolase. In some species, histidine is converted to via urocanate and then formimino-L-glutamate to glutamate in four steps, where the fourth step is conversion of N-formimino-L-glutamate to L-glutamate and formamide. In others, that pathway from formimino-L-glutamate may differ, with the next enzyme being formiminoglutamate hydrolase (HutF) yielding N-formyl-L-glutamate. This model represents the enzyme N-formylglutamate deformylase, also called N-formylglutamate amidohydrolase, which then produces glutamate.
Probab=14.07  E-value=87  Score=30.04  Aligned_cols=19  Identities=37%  Similarity=0.751  Sum_probs=15.3

Q ss_pred             CCCCCCCCCCcccccccCCC
Q 017568           16 DYDPTPYDGGYDITLTYGRP   35 (369)
Q Consensus        16 eydPtPYgGGYDi~~tYG~p   35 (369)
                      -=+-.||-||| |+-+||+|
T Consensus       194 v~~N~Py~Gg~-itr~yg~p  212 (263)
T TIGR02017       194 HVLNGRFKGGW-ITRHYGQP  212 (263)
T ss_pred             EEeCCCCCCcc-eecccCCC
Confidence            33567999999 57799998


No 8  
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional
Probab=12.68  E-value=92  Score=32.20  Aligned_cols=30  Identities=30%  Similarity=0.410  Sum_probs=24.8

Q ss_pred             cCCceehhhHHHHHHHHHHHHHHHH-HHhHh
Q 017568          333 IRSPVVMVMRDVVMMMNIAAGLMSM-AMDAR  362 (369)
Q Consensus       333 ~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~  362 (369)
                      +..|||+|.+.-.+..|||+-|..+ ..+.+
T Consensus       104 l~~PviLVv~~~~g~~s~aa~l~g~~~~~~~  134 (433)
T PRK13896        104 LDLPVVLVVDAKAGMESVAATALGFRAYADR  134 (433)
T ss_pred             HCCCEEEEEcCcccHHHHHHHHHHHHHHHHh
Confidence            4679999999999999999998886 55543


No 9  
>PF07054 Pericardin_rpt:  Pericardin like repeat;  InterPro: IPR009765 This entry represents a repeated sequence of around 34 residues in length, which is found in multiple copies in Drosophila pericardin and other extracellular matrix proteins [, ].
Probab=10.74  E-value=3.9e+02  Score=19.49  Aligned_cols=12  Identities=67%  Similarity=1.306  Sum_probs=5.4

Q ss_pred             CCCCCCCCCCCC
Q 017568          108 QPAYGFQPGMGR  119 (369)
Q Consensus       108 ~P~Yg~qpGYGg  119 (369)
                      +|.|+.||+-|+
T Consensus        18 QpGYg~QPGvGg   29 (34)
T PF07054_consen   18 QPGYGTQPGVGG   29 (34)
T ss_pred             CCccccCCccCC
Confidence            444444444443


No 10 
>PLN03021 Low-temperature-induced protein; Provisional
Probab=10.47  E-value=2.7e+02  Score=30.50  Aligned_cols=59  Identities=29%  Similarity=0.490  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCcccccccCCC-------------------------CCCCCCCccCCCC-CCCCCCCCCCCCC
Q 017568            8 DDDVTDFDDYDPTPYDGGYDITLTYGRP-------------------------LPPSDETCYPSSS-ASDGDFDYARPKF   61 (369)
Q Consensus         8 ~~~~~~fdeydPtPYgGGYDi~~tYG~p-------------------------lpps~etcyP~Ss-asd~d~sYdRP~y   61 (369)
                      ++++|++|+-||.          .-|.|                         +|+++|+.=|-.- ---...+|-.|.=
T Consensus        63 ~~edde~de~~~e----------~h~apv~e~s~vrg~~tgkp~sl~h~ge~nvpa~eeivppgtk~fpvvss~~tkp~e  132 (619)
T PLN03021         63 EDDDDEYDEQDPE----------VHGAPVYESSAVRGGVTGKPKSLSHAGETNVPASEEIVPPGTKVFPVVSSDHTKPIE  132 (619)
T ss_pred             ccccccccccchh----------hcCCcccccccccccccCCcccccCccccCCCCcccccCCCCcccceecccccCcCC


Q ss_pred             CCCCCCCccchhhhh
Q 017568           62 SSHSEPSAYADEALN   76 (369)
Q Consensus        62 ~S~sEPSaY~deal~   76 (369)
                      +-..+-..|+++|++
T Consensus       133 pv~~~~~~yghea~~  147 (619)
T PLN03021        133 PVSLQDTSYGHEALA  147 (619)
T ss_pred             ccccccccccccccc


Done!