BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 017576
         (369 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2IA2|A Chain A, The Crystal Structure Of A Putative Transcriptional
           Regulator Rha06195 From Rhodococcus Sp. Rha1
 pdb|2IA2|B Chain B, The Crystal Structure Of A Putative Transcriptional
           Regulator Rha06195 From Rhodococcus Sp. Rha1
 pdb|2IA2|C Chain C, The Crystal Structure Of A Putative Transcriptional
           Regulator Rha06195 From Rhodococcus Sp. Rha1
 pdb|2IA2|D Chain D, The Crystal Structure Of A Putative Transcriptional
           Regulator Rha06195 From Rhodococcus Sp. Rha1
          Length = 265

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 3/39 (7%)

Query: 157 LPMGYPVLQQPPIPAAGQPHLESMSSGI---SSCHVVNG 192
           L +GY  L    +P   QPHLE +S  +   SS  +++G
Sbjct: 80  LELGYSYLSSLSLPEVAQPHLEKLSHKVHESSSVSILDG 118


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.131    0.384 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,430,421
Number of Sequences: 62578
Number of extensions: 445213
Number of successful extensions: 1044
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1044
Number of HSP's gapped (non-prelim): 3
length of query: 369
length of database: 14,973,337
effective HSP length: 100
effective length of query: 269
effective length of database: 8,715,537
effective search space: 2344479453
effective search space used: 2344479453
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 52 (24.6 bits)