Citrus Sinensis ID: 017579

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37

MMTVFPPRNGAQKLLGIIIAIGEAVAYVLSGMYGSVNQLGVGNAILIIVQLCFAGIIVICLDELLQKGYGLGSGISLFIATNICENIIWKAFSPTTINSGRGAEFEGAVIALFHLLITRNDKVRALREAFYRQNLPNVTNLLATVLIFLIVIYFQGFRVVLPVRSKNARGQQGSYPIKLFYTSNMPIILQSALVSNLYFISQLMYRRYSGNFFVNLLGKWKESEYSGGQYVPVGGIAYYITAPSSLADMAANPFHALFYLVFMLSACALFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERASELGFFGF

cccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccCCcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccEEEEEEcccccccccccccCEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEECccccccccCECcccEEEEEcccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccEEccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc

***VF*PRNGAQKLLGIIIAIGEAVAYVLSGMYGSVNQLGVGNAILIIVQLCFAGIIVICLDELLQKGYGLGSGISLFIATNICENIIWKAFSPTTINSGRGAEFEGAVIALFHLLITRNDKVRALREAFYRQNLPNVTNLLATVLIFLIVIYFQGFRVVLPVRSKNARGQQGSYPIKLFYTSNMPIILQSALVSNLYFISQLMYRRYSGNFFVNLLGKWKESEYSGGQYVPVGGIAYYITAPSSLADMAANPFHALFYLVFMLSACALFSKTWIEVSGSSA************VMPGHREANLQKELNRYIPTAAAFGGMCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKE**********

xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein transport protein Sec61 subunit alpha-like 2	Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.	probable	Q90YL4
Protein transport protein Sec61 subunit alpha-like 1	Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.	probable	Q90ZM2
Protein transport protein Sec61 subunit alpha isoform 2	Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.	probable	Q2KHX4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WWB, chain A
Confidence level:very confident
Coverage over the Query: 7-366
View the alignment between query and template
View the model in PyMOL