BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 017604
(369 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2IA2|A Chain A, The Crystal Structure Of A Putative Transcriptional
Regulator Rha06195 From Rhodococcus Sp. Rha1
pdb|2IA2|B Chain B, The Crystal Structure Of A Putative Transcriptional
Regulator Rha06195 From Rhodococcus Sp. Rha1
pdb|2IA2|C Chain C, The Crystal Structure Of A Putative Transcriptional
Regulator Rha06195 From Rhodococcus Sp. Rha1
pdb|2IA2|D Chain D, The Crystal Structure Of A Putative Transcriptional
Regulator Rha06195 From Rhodococcus Sp. Rha1
Length = 265
Score = 30.0 bits (66), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 3/39 (7%)
Query: 157 LPMGYPVLQQPPIPAAGQPHLESMSSGI---SSCHVVNG 192
L +GY L +P QPHLE +S + SS +++G
Sbjct: 80 LELGYSYLSSLSLPEVAQPHLEKLSHKVHESSSVSILDG 118
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.131 0.384
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,430,421
Number of Sequences: 62578
Number of extensions: 445213
Number of successful extensions: 1044
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1044
Number of HSP's gapped (non-prelim): 3
length of query: 369
length of database: 14,973,337
effective HSP length: 100
effective length of query: 269
effective length of database: 8,715,537
effective search space: 2344479453
effective search space used: 2344479453
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 52 (24.6 bits)