Citrus Sinensis ID: 017653

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37

MATTEQTLKVNREKLVACMTCPLCSKLFRDATTISECLHSFCRKCIYEKITEEEIDSCPVCNTDLGCAPLEKLRADHNLQDLRIKIFPSKRRNLDAPDSVSSVPLPARRKEISLSSLAISTPKSPVKSSSSGRRSKPVPKKTLVQEEYTSPIEEPIKDVEDPPELSSEPLCRNTQTKRQILSAAESSIQHTPDKGTEDIARPFDGKSDLWKPLNVLVEAATRPRKSLGRPKKAAVSAGLNVSAQAVVDTNQRFDGRFGPIWFSLVASDEQEGDEPLPQISSCYLRVKDGRLPVSFIKRYIVKKLNLISEAEVEISLRGQPVLSTLELHNLINWWVQTSSASERIQTVVGSSAKDFVMVLSYGRKAQPP

ccccccEEEEcccccccccccHHHHccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHcccccccccccccHHcccccccccccccccccccccccccEEEEEcccccccccccccccccEEEECcccccHHHHHHHHHHHHccccccEEEEEEccccccccccHHHHHHHHHcccccccccccccccccccEEEEEECccccccc

*********VNREKLVACMTCPLCSKLFRDATTISECLHSFCRKCIYEKITEEEIDSCPVCNTDLGCAPLEKLRADHNLQDLRIKIF*************************************************************************************************************************LWKPLNVLVE*************************************RFGPIWFSLVA***********QISSCYLRVKDGRLPVSFIKRYIVKKLNLISEAEVEISLRGQPVLSTLELHNLINWWVQTSSASERIQTVVGSSAKDFVMVLSYGR*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin protein ligase DRIP2	E3 ubiquitin-protein ligase that acts as a negative regulator of the response to water stress. Mediates ubiquitination and subsequent proteasomal degradation of the drought-induced transcriptional activator DREB2A. Functionally redundant with DRIP1.	probable	Q94AY3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CKL, chain B
Confidence level:very confident
Coverage over the Query: 14-87
View the alignment between query and template
View the model in PyMOL

Template: 3GS2, chain A
Confidence level:probable
Coverage over the Query: 260-338
View the alignment between query and template
View the model in PyMOL