Query         017655
Match_columns 368
No_of_seqs    94 out of 96
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 10:31:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/017655.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/017655hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10453 NUFIP1:  Nuclear fragi  99.1 4.4E-11 9.5E-16   91.4   4.8   34   94-128    13-46  (56)
  2 PF00642 zf-CCCH:  Zinc finger   77.1    0.83 1.8E-05   29.9   0.2   25  186-212     2-27  (27)
  3 smart00356 ZnF_C3H1 zinc finge  61.9     6.5 0.00014   24.5   1.8   23  187-211     4-26  (27)
  4 KOG2185 Predicted RNA-processi  44.1      12 0.00025   39.6   1.4   28  186-215   139-166 (486)
  5 KOG1677 CCCH-type Zn-finger pr  31.5      29 0.00062   33.6   1.8   29  183-213   173-202 (332)
  6 PF12728 HTH_17:  Helix-turn-he  29.7      27 0.00059   24.8   1.0   16   98-113    36-51  (51)
  7 COG3311 AlpA Predicted transcr  28.0      49  0.0011   26.9   2.2   18   98-115    50-67  (70)
  8 KOG1492 C3H1-type Zn-finger pr  27.5      26 0.00056   34.8   0.7   26  186-214   205-232 (377)
  9 PF10471 APC_CDC26:  Anaphase-p  26.7      14 0.00031   29.5  -1.0   24   92-115     3-26  (79)
 10 KOG1763 Uncharacterized conser  24.8      61  0.0013   33.2   2.8   32  184-217    89-120 (343)
 11 KOG4031 Vesicle coat protein c  22.3 2.9E+02  0.0063   27.0   6.6   20   96-115    99-118 (216)

No 1  
>PF10453 NUFIP1:  Nuclear fragile X mental retardation-interacting protein 1 (NUFIP1);  InterPro: IPR019496 Nuclear fragile X mental retardation-interacting protein 1 (Nufip1) has been implicated in the assembly of the large subunit of the ribosome [] and in telomere maintenance []. It is known to bind RNA [] and is phosphorylated upon DNA damage []. This entry represents a conserved domain found within Nufip1. Some proteins containing this region also contain a CCCH zinc finger.
Probab=99.15  E-value=4.4e-11  Score=91.38  Aligned_cols=34  Identities=62%  Similarity=0.940  Sum_probs=30.1

Q ss_pred             cccccccCHHHHHHHHHHHHhcCCChHHHHHHHHh
Q 017655           94 KSLALTYTEQEVKQWCEERRKNYPTKANINKKLTE  128 (368)
Q Consensus        94 k~~~l~~t~eEI~aWraERKKNyPT~aNVekK~ae  128 (368)
                      +++.| +||+||++||+||||||||++||++|+.+
T Consensus        13 ~~~~L-~t~eeI~~W~eERrk~~PT~~~i~~k~~~   46 (56)
T PF10453_consen   13 TSIKL-QTPEEIAKWIEERRKNYPTKANIEKKKAE   46 (56)
T ss_pred             ceeec-CCHHHHHHHHHHHHHcCCcHHHHHHHHHH
Confidence            55555 69999999999999999999999988875


No 2  
>PF00642 zf-CCCH:  Zinc finger C-x8-C-x5-C-x3-H type (and similar);  InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents C-x8-C-x5-C-x3-H (CCCH) type Zinc finger (Znf) domains. Proteins containing CCCH Znf domains include Znf proteins from eukaryotes involved in cell cycle or growth phase-related regulation, e.g. human TIS11B (butyrate response factor 1), a probable regulatory protein involved in regulating the response to growth factors, and the mouse TTP growth factor-inducible nuclear protein, which has the same function. The mouse TTP protein is induced by growth factors. Another protein containing this domain is the human splicing factor U2AF 35kDa subunit, which plays a critical role in both constitutive and enhancer-dependent splicing by mediating essential protein-protein interactions and protein-RNA interactions required for 3' splice site selection. It has been shown that different CCCH-type Znf proteins interact with the 3'-untranslated region of various mRNA [, ]. This type of Znf is very often present in two copies. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 1M9O_A 1RGO_A 2CQE_A 2FC6_A 2D9M_A 2E5S_A 2RHK_C 2D9N_A 3D2S_A 3D2Q_C ....
Probab=77.12  E-value=0.83  Score=29.90  Aligned_cols=25  Identities=20%  Similarity=0.158  Sum_probs=16.9

Q ss_pred             CCCCcceecc-CCCccccCCCCCcchhh
Q 017655          186 LNKRGRFQNN-YDKRGRYKRKDQFSKEQ  212 (368)
Q Consensus       186 ~sk~CKF~nr-g~~RgRcgrKcrf~h~~  212 (368)
                      .+..|+||.+ |.|+  +|..|+|+|.+
T Consensus         2 k~~~C~~f~~~g~C~--~G~~C~f~H~~   27 (27)
T PF00642_consen    2 KTKLCRFFMRTGTCP--FGDKCRFAHGE   27 (27)
T ss_dssp             TSSB-HHHHHTS--T--TGGGSSSBSSG
T ss_pred             ccccChhhccCCccC--CCCCcCccCCC
Confidence            3578998887 6654  78899999863


No 3  
>smart00356 ZnF_C3H1 zinc finger.
Probab=61.89  E-value=6.5  Score=24.45  Aligned_cols=23  Identities=13%  Similarity=0.159  Sum_probs=16.9

Q ss_pred             CCCcceeccCCCccccCCCCCcchh
Q 017655          187 NKRGRFQNNYDKRGRYKRKDQFSKE  211 (368)
Q Consensus       187 sk~CKF~nrg~~RgRcgrKcrf~h~  211 (368)
                      +..|++|.+|.|.  .|..|+|.|.
T Consensus         4 ~~~C~~~~~g~C~--~g~~C~~~H~   26 (27)
T smart00356        4 TELCKFFKRGYCP--YGDRCKFAHP   26 (27)
T ss_pred             CCcCcCccCCCCC--CCCCcCCCCc
Confidence            4579999777764  5667888875


No 4  
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification]
Probab=44.12  E-value=12  Score=39.63  Aligned_cols=28  Identities=18%  Similarity=0.146  Sum_probs=23.0

Q ss_pred             CCCCcceeccCCCccccCCCCCcchhhhhh
Q 017655          186 LNKRGRFQNNYDKRGRYKRKDQFSKEQKLA  215 (368)
Q Consensus       186 ~sk~CKF~nrg~~RgRcgrKcrf~h~~~~~  215 (368)
                      .-++|+||.-|-||  ++-.|||+|-.-+.
T Consensus       139 sMkpC~ffLeg~CR--F~enCRfSHG~~V~  166 (486)
T KOG2185|consen  139 SMKPCKFFLEGRCR--FGENCRFSHGLDVP  166 (486)
T ss_pred             hhccchHhhccccc--cCcccccccCcccc
Confidence            45789999999886  99999999965444


No 5  
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only]
Probab=31.54  E-value=29  Score=33.58  Aligned_cols=29  Identities=10%  Similarity=-0.075  Sum_probs=23.0

Q ss_pred             CCCCCCCcceecc-CCCccccCCCCCcchhhh
Q 017655          183 TMPLNKRGRFQNN-YDKRGRYKRKDQFSKEQK  213 (368)
Q Consensus       183 kk~~sk~CKF~nr-g~~RgRcgrKcrf~h~~~  213 (368)
                      .+-.++.|.+|.+ |.|.  ||..|+|.|-..
T Consensus       173 ~~~kt~lC~~f~~tG~C~--yG~rC~F~H~~~  202 (332)
T KOG1677|consen  173 PKYKTKLCPKFQKTGLCK--YGSRCRFIHGEP  202 (332)
T ss_pred             CCCCCcCCCccccCCCCC--CCCcCeecCCCc
Confidence            3558899999887 7775  899999999643


No 6  
>PF12728 HTH_17:  Helix-turn-helix domain
Probab=29.65  E-value=27  Score=24.75  Aligned_cols=16  Identities=25%  Similarity=0.677  Sum_probs=14.4

Q ss_pred             cccCHHHHHHHHHHHH
Q 017655           98 LTYTEQEVKQWCEERR  113 (368)
Q Consensus        98 l~~t~eEI~aWraERK  113 (368)
                      +.++.+||.+|+++++
T Consensus        36 ~~~~~~~l~~~~~~~~   51 (51)
T PF12728_consen   36 WRIPKSDLDRWLERRR   51 (51)
T ss_pred             EEEeHHHHHHHHHhCc
Confidence            7899999999999875


No 7  
>COG3311 AlpA Predicted transcriptional regulator [Transcription]
Probab=27.95  E-value=49  Score=26.90  Aligned_cols=18  Identities=22%  Similarity=0.728  Sum_probs=15.3

Q ss_pred             cccCHHHHHHHHHHHHhc
Q 017655           98 LTYTEQEVKQWCEERRKN  115 (368)
Q Consensus        98 l~~t~eEI~aWraERKKN  115 (368)
                      +.....||.+|++.|+.+
T Consensus        50 v~W~~SEI~~Wi~~~~~~   67 (70)
T COG3311          50 VAWPESEIDEWIASRKAA   67 (70)
T ss_pred             ccccHHHHHHHHHHHHhc
Confidence            567899999999999764


No 8  
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only]
Probab=27.52  E-value=26  Score=34.85  Aligned_cols=26  Identities=15%  Similarity=0.082  Sum_probs=19.1

Q ss_pred             CCCCcceeccCCCccccCCC--CCcchhhhh
Q 017655          186 LNKRGRFQNNYDKRGRYKRK--DQFSKEQKL  214 (368)
Q Consensus       186 ~sk~CKF~nrg~~RgRcgrK--crf~h~~~~  214 (368)
                      ..--||||+-+|   -||++  |||+|.|..
T Consensus       205 savycryynang---icgkgaacrfvheptr  232 (377)
T KOG1492|consen  205 SAVYCRYYNANG---ICGKGAACRFVHEPTR  232 (377)
T ss_pred             ceeEEEEecCCC---cccCCceeeeeccccc
Confidence            344699998776   58774  999997644


No 9  
>PF10471 APC_CDC26:  Anaphase-promoting complex APC subunit 1;  InterPro: IPR018860  The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome. Anaphase is initiated when the APC triggers the destruction of securin, thereby allowing the protease, separase, to disrupt sister-chromatid cohesion. Securin ubiquitination by the APC is inhibited by cyclin-dependent kinase 1 (Cdk1)-dependent phosphorylation []. Forkhead Box M1 (FoxM1), which is a transcription factor that is over-expressed in many cancers, is degraded in late mitosis and early G1 phase by the APC/cyclosome (APC/C) E3 ubiquitin ligase []. The APC/C targets mitotic cyclins for destruction in mitosis and G1 phase and is then inactivated at S phase. It thereby generates alternating states of high and low cyclin-Cdk activity, which is required for the alternation of mitosis and DNA replication []. The APC/C is composed of at least 13 subunits that stay tightly associated throughout the cell cycle: APC1, APC2, APC4, APC5, APC9, APC11, CDC16, CDC23, CDC26, CDC27, DOC1, MND2 and SWM1[], []. In fission yeast the 13 subunits are known as: Apc1, Apc2, Nuc2, Apc4, Apc5, Cut9, Apc8, Apc10, Apc11, Hcn1, Apc13, Apc14 and Apc15 []. This entry represents subunit CDC26, whose exact function is not known [].; GO: 0030071 regulation of mitotic metaphase/anaphase transition, 0031145 anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process, 0005680 anaphase-promoting complex; PDB: 2XPI_E 3HYM_A.
Probab=26.72  E-value=14  Score=29.48  Aligned_cols=24  Identities=17%  Similarity=0.487  Sum_probs=11.3

Q ss_pred             cccccccccCHHHHHHHHHHHHhc
Q 017655           92 KRKSLALTYTEQEVKQWCEERRKN  115 (368)
Q Consensus        92 ~rk~~~l~~t~eEI~aWraERKKN  115 (368)
                      +|+|-.|..+++||..|.+.|+..
T Consensus         3 RR~pT~I~Lt~eDi~eye~~~~~~   26 (79)
T PF10471_consen    3 RRKPTTIELTLEDIAEYEDRRKEQ   26 (79)
T ss_dssp             ----------CHHHHHHCCCHHH-
T ss_pred             CCCCcEEEecHHHHHHHHHHHHHH
Confidence            577888999999999998877653


No 10 
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only]
Probab=24.82  E-value=61  Score=33.22  Aligned_cols=32  Identities=19%  Similarity=0.098  Sum_probs=24.1

Q ss_pred             CCCCCCcceeccCCCccccCCCCCcchhhhhhcC
Q 017655          184 MPLNKRGRFQNNYDKRGRYKRKDQFSKEQKLADK  217 (368)
Q Consensus       184 k~~sk~CKF~nrg~~RgRcgrKcrf~h~~~~~nk  217 (368)
                      .+.+=.|-|+..|.|.  -|.+|+|+|+-.+..+
T Consensus        89 DPKSvvCafFk~g~C~--KG~kCKFsHdl~~~~k  120 (343)
T KOG1763|consen   89 DPKSVVCAFFKQGTCT--KGDKCKFSHDLAVERK  120 (343)
T ss_pred             CchHHHHHHHhccCCC--CCCcccccchHHHhhh
Confidence            3456789999988864  6778999998655543


No 11 
>KOG4031 consensus Vesicle coat protein clathrin, light chain [Intracellular trafficking, secretion, and vesicular transport]
Probab=22.29  E-value=2.9e+02  Score=27.04  Aligned_cols=20  Identities=25%  Similarity=0.494  Sum_probs=16.9

Q ss_pred             cccccCHHHHHHHHHHHHhc
Q 017655           96 LALTYTEQEVKQWCEERRKN  115 (368)
Q Consensus        96 ~~l~~t~eEI~aWraERKKN  115 (368)
                      +.+...|+=|++|++++++.
T Consensus        99 ~~~~~epE~IRkWkeeQ~~r  118 (216)
T KOG4031|consen   99 PRLRDEPEKIRKWKEEQMKR  118 (216)
T ss_pred             CCcccChHHHHHHHHHHHHH
Confidence            34778999999999999874


Done!