Citrus Sinensis ID: 017673


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MAAKKLSETFSKSLIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHLHLMVFELVKNSLRAVEERYMDSDKVAPPIRIIVADGLEDVTIKVSDEGGGIPRSGLPKIFTYLYSTARNPLDENTDLAADKGTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSQEPLP
cccccccHHHHHHHHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccEEEEEEcccccEEEEEEEccccccccccc
*************LIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHLHLMVFELVKNSLRAVEERYMDSDKVAPPIRIIVADGLEDVTIKVSDEGGGIPRSGLPKIFTYLYSTAR***********DKGTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLG*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKKLSETFSKSLIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHLHLMVFELVKNSLRAVEERYMDSDKVAPPIRIIVADGLEDVTIKVSDEGGGIPRSGLPKIFTYLYSTARNPLDENTDLAADKGTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSQEPLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
[Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial Serine protein kinase that inhibits the mitochondrial pyruvate dehydrogenase (PDH) complex (mtPDC) by phosphorylation of the E1 alpha subunit on Ser residues, thus contributing to the regulation of glucose metabolism.confidentQ9SBJ1
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial Inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.probableQ15119
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial Inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.probableQ9JK42

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.2Transferred entry: 2.7.11.2.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E0A, chain A
Confidence level:very confident
Coverage over the Query: 14-306,317-368
View the alignment between query and template
View the model in PyMOL
Template: 3VAD, chain A
Confidence level:confident
Coverage over the Query: 24-303,321-361
View the alignment between query and template
View the model in PyMOL