BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 017686
(367 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2OCW|A Chain A, Solution Structure Of Human Secretory Component
pdb|3CHN|S Chain S, Solution Structure Of Human Secretory Iga1
pdb|3CM9|S Chain S, Solution Structure Of Human Siga2
Length = 585
Score = 29.3 bits (64), Expect = 3.6, Method: Compositional matrix adjust.
Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 13/66 (19%)
Query: 201 PSNQTEVLNVTEDIQDPGASHQGELPTDSEGL---------QEPGPSNQTEV----LGET 247
P N T V+N+ + QD ++ L +S GL Q PG N T+V LG T
Sbjct: 70 PENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVYTVDLGRT 129
Query: 248 VELQEP 253
V + P
Sbjct: 130 VTINCP 135
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.132 0.389
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,825,006
Number of Sequences: 62578
Number of extensions: 517244
Number of successful extensions: 811
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 810
Number of HSP's gapped (non-prelim): 3
length of query: 367
length of database: 14,973,337
effective HSP length: 100
effective length of query: 267
effective length of database: 8,715,537
effective search space: 2327048379
effective search space used: 2327048379
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 52 (24.6 bits)