Citrus Sinensis ID: 017713

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------

MEDFCLLSFRSLNFSIEWLVLQLLVLLGGPEDNVAEYYQQQVQMLEGFNEMDALAERGFVPGMTKEERENLARSETLAIRISNVANMVLFAAKVYASVKSGSLAIIASTLDSLLDLLSGFILWFTAFSMQTPNPYQYPIGKKRMQPLGILVFASVMATLGLQIILESLRTLVSNEDQFNLTKEQEQWVVGIMLSVTLVKLLLVVYCRAFTNEIVKAYAQDHFFDVITNIIGLVAVLLANYIDDWMDPVGAIILALYTIRTWSMTVLENVNSLVGRSAAPEYLQKLTYLCWNHHKSIRHIDTVRAYTFGSHYFVEVDIVLPASMPLQEAHDIGESLQEKLELLPEIERAFVHLDYEYTHRPEHAQAHY

ccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccHccccc

***FCLLSFRSLNFSIEWLVLQLLVLLGGPEDNVAEYYQQQVQMLEGFNEMDALAERGFV*************SETLAIRISNVANMVLFAAKVYASVKSGSLAIIASTLDSLLDLLSGFILWFTAFSMQTPNPYQYPIGKKRMQPLGILVFASVMATLGLQIILESLRTLVSNEDQFNLTKEQEQWVVGIMLSVTLVKLLLVVYCRAFTNEIVKAYAQDHFFDVITNIIGLVAVLLANYIDDWMDPVGAIILALYTIRTWSMTVLENVNSLVGRSAAPEYLQKLTYLCWNHHKSIRHIDTVRAYTFGSHYFVEVDIVLPASMPLQEAHDIGESLQEKLELLPEIERAFVHLDYEYT**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Metal tolerance protein 11	Cation/proton antiporter involved in endogenous manganese tolerance probably through vesicular trafficking and exocytosis.	confident	O80632
Metal tolerance protein 5	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	confident	Q5NA18
Metal tolerance protein 6	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	probable	Q0DHJ5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H90, chain A
Confidence level:very confident
Coverage over the Query: 92-357
View the alignment between query and template
View the model in PyMOL