Citrus Sinensis ID: 017745
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 366 | ||||||
| 224095037 | 560 | predicted protein [Populus trichocarpa] | 0.983 | 0.642 | 0.824 | 1e-172 | |
| 255568615 | 705 | N-acetyltransferase, putative [Ricinus c | 1.0 | 0.519 | 0.763 | 1e-166 | |
| 356565491 | 565 | PREDICTED: amino-acid acetyltransferase- | 0.989 | 0.640 | 0.794 | 1e-165 | |
| 356514348 | 617 | PREDICTED: LOW QUALITY PROTEIN: amino-ac | 0.989 | 0.586 | 0.794 | 1e-164 | |
| 297821519 | 609 | hypothetical protein ARALYDRAFT_481154 [ | 1.0 | 0.600 | 0.772 | 1e-163 | |
| 3445208 | 620 | putative amino acid acetyltransferase [A | 1.0 | 0.590 | 0.766 | 1e-163 | |
| 30681866 | 609 | amino-acid N-acetyltransferase [Arabidop | 1.0 | 0.600 | 0.766 | 1e-163 | |
| 356540624 | 607 | PREDICTED: amino-acid acetyltransferase- | 0.983 | 0.593 | 0.795 | 1e-162 | |
| 375155307 | 600 | N-acetyl-glutamate synthase [Solanum tor | 0.991 | 0.605 | 0.778 | 1e-162 | |
| 350535106 | 603 | N-acetyl-glutamate synthase [Solanum lyc | 0.991 | 0.601 | 0.772 | 1e-162 |
| >gi|224095037|ref|XP_002310336.1| predicted protein [Populus trichocarpa] gi|222853239|gb|EEE90786.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 612 bits (1577), Expect = e-172, Method: Compositional matrix adjust.
Identities = 301/365 (82%), Positives = 328/365 (89%), Gaps = 5/365 (1%)
Query: 1 MRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHL 60
MRERLDGGC+V+LSNLGYSSSGEVLNCNTYEVATACALAI ADKLIC+IDGPILDESGHL
Sbjct: 200 MRERLDGGCIVVLSNLGYSSSGEVLNCNTYEVATACALAIGADKLICVIDGPILDESGHL 259
Query: 61 IRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERR 120
IRFLTL+EAD LIR+R KQSEIAA+YVKAV +ED+T H+DSIG + SS NGK S R
Sbjct: 260 IRFLTLEEADMLIRKRAKQSEIAAHYVKAVGDEDLTFLEHNDSIGILASSLNGKALSGRH 319
Query: 121 IATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDG 180
ATF NGVGFDNGNG QGFAIGG+E SRLNGYLSELAAAAFVC+ GVQRVHLLDG
Sbjct: 320 SATFQNGVGFDNGNG-----QGFAIGGEELQSRLNGYLSELAAAAFVCKGGVQRVHLLDG 374
Query: 181 TIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEEL 240
TI GVLLLELFKRDGMGTMVASDLYEGTR A+VTDL+GI+QIIQPL ESG LVRRTDEEL
Sbjct: 375 TISGVLLLELFKRDGMGTMVASDLYEGTRMARVTDLAGIRQIIQPLEESGTLVRRTDEEL 434
Query: 241 LKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAA 300
LKAL ++ VVEREGQIIACAALFPFF+EKCGEVAAI VSPECRGQGQGDKLLD+IE++A+
Sbjct: 435 LKALYAYVVVEREGQIIACAALFPFFEEKCGEVAAIAVSPECRGQGQGDKLLDFIERRAS 494
Query: 301 SLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGII 360
SLGL+ LFLLTTRTADWF RGF ECSI++IPEERRK+INLSRNSKYY KKLLPDTSGI
Sbjct: 495 SLGLETLFLLTTRTADWFNRRGFSECSIQLIPEERRKKINLSRNSKYYTKKLLPDTSGIS 554
Query: 361 VDRAF 365
V+RAF
Sbjct: 555 VNRAF 559
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255568615|ref|XP_002525281.1| N-acetyltransferase, putative [Ricinus communis] gi|223535439|gb|EEF37109.1| N-acetyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356565491|ref|XP_003550973.1| PREDICTED: amino-acid acetyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356514348|ref|XP_003525868.1| PREDICTED: LOW QUALITY PROTEIN: amino-acid acetyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297821519|ref|XP_002878642.1| hypothetical protein ARALYDRAFT_481154 [Arabidopsis lyrata subsp. lyrata] gi|297324481|gb|EFH54901.1| hypothetical protein ARALYDRAFT_481154 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|3445208|gb|AAC32438.1| putative amino acid acetyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|30681866|ref|NP_179875.2| amino-acid N-acetyltransferase [Arabidopsis thaliana] gi|28393691|gb|AAO42258.1| putative amino acid acetyltransferase [Arabidopsis thaliana] gi|29824347|gb|AAP04134.1| putative amino acid acetyltransferase [Arabidopsis thaliana] gi|330252278|gb|AEC07372.1| amino-acid N-acetyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356540624|ref|XP_003538787.1| PREDICTED: amino-acid acetyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|375155307|gb|AFA37977.1| N-acetyl-glutamate synthase [Solanum torvum] | Back alignment and taxonomy information |
|---|
| >gi|350535106|ref|NP_001234432.1| N-acetyl-glutamate synthase [Solanum lycopersicum] gi|237780684|gb|ACR19334.1| N-acetyl-glutamate synthase [Solanum lycopersicum] gi|449076253|gb|AGE83531.1| calcium-dependent protein kinase 2, partial [Solanum melongena] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 366 | ||||||
| TAIR|locus:2059165 | 609 | NAGS1 "N-acetyl-l-glutamate sy | 1.0 | 0.600 | 0.737 | 8e-140 | |
| TAIR|locus:2120130 | 613 | NAGS2 "N-acetyl-l-glutamate sy | 0.986 | 0.588 | 0.743 | 1.1e-137 | |
| UNIPROTKB|P22567 | 432 | argA "Amino-acid acetyltransfe | 0.551 | 0.467 | 0.490 | 3.8e-56 | |
| UNIPROTKB|P0A6C5 | 443 | argA [Escherichia coli K-12 (t | 0.592 | 0.489 | 0.403 | 1.8e-48 | |
| TIGR_CMR|CPS_0465 | 436 | CPS_0465 "amino-acid N-acetylt | 0.497 | 0.417 | 0.417 | 2.6e-47 | |
| TIGR_CMR|SO_4245 | 445 | SO_4245 "amino-acid acetyltran | 0.540 | 0.444 | 0.393 | 7.6e-44 | |
| UNIPROTKB|Q9KPQ0 | 445 | argA "Amino-acid acetyltransfe | 0.524 | 0.431 | 0.375 | 9.5e-42 | |
| TIGR_CMR|VC_2316 | 445 | VC_2316 "N-acetylglutamate syn | 0.524 | 0.431 | 0.375 | 9.5e-42 | |
| UNIPROTKB|O33289 | 174 | argA "Amino-acid acetyltransfe | 0.325 | 0.683 | 0.299 | 6.8e-09 | |
| TIGR_CMR|GSU_2061 | 149 | GSU_2061 "acetyltransferase, G | 0.338 | 0.832 | 0.285 | 6.8e-09 |
| TAIR|locus:2059165 NAGS1 "N-acetyl-l-glutamate synthase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1368 (486.6 bits), Expect = 8.0e-140, P = 8.0e-140
Identities = 272/369 (73%), Positives = 309/369 (83%)
Query: 1 MRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHL 60
+RERLD G +V+L NLG+SS+GEVLNCNTYEVATACALAI ADKLICI+DGP+LDE+GHL
Sbjct: 238 IRERLDSGSVVLLRNLGHSSTGEVLNCNTYEVATACALAIGADKLICIMDGPVLDENGHL 297
Query: 61 IRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQN---GKTFS 117
+RFLTLQEAD+L+R+R +QSEIAANYVKAV + I+ F + ++ N G+
Sbjct: 298 VRFLTLQEADTLVRKRAQQSEIAANYVKAVGDGGISSFPEPLGYNGMVTTPNNHIGRPIW 357
Query: 118 ERRIATXXXXXXXXXXXXLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHL 177
E+ T LWS EQGFAIGG+ER+SRLNGYLSELAAAAFVCR GV+RVHL
Sbjct: 358 EKLSPTFQNGVGFDNGNGLWSGEQGFAIGGEERISRLNGYLSELAAAAFVCRGGVKRVHL 417
Query: 178 LDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTD 237
LDGTI GVLLLELFKRDGMGTMVASD+YEG R AKV DL+GI+QII+PL ESGALVRRTD
Sbjct: 418 LDGTISGVLLLELFKRDGMGTMVASDVYEGNREAKVEDLAGIRQIIKPLEESGALVRRTD 477
Query: 238 EELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEK 297
EELL+ALDSF VVEREG IIACAALFPFF+EKCGEVAAI V+ +CRGQGQGDKLLDYIEK
Sbjct: 478 EELLRALDSFVVVEREGHIIACAALFPFFEEKCGEVAAIAVASDCRGQGQGDKLLDYIEK 537
Query: 298 KAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTS 357
KA++LGL+MLFLLTTRTADWF RGF+EC IEMIPE RR+RINLSR SKYYMKKLLPD S
Sbjct: 538 KASALGLEMLFLLTTRTADWFVRRGFQECPIEMIPEARRERINLSRRSKYYMKKLLPDRS 597
Query: 358 GIIVDRAFR 366
GI V R F+
Sbjct: 598 GISVVRTFQ 606
|
|
| TAIR|locus:2120130 NAGS2 "N-acetyl-l-glutamate synthase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P22567 argA "Amino-acid acetyltransferase" [Pseudomonas aeruginosa PAO1 (taxid:208964)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A6C5 argA [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_0465 CPS_0465 "amino-acid N-acetyltransferase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_4245 SO_4245 "amino-acid acetyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KPQ0 argA "Amino-acid acetyltransferase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2316 VC_2316 "N-acetylglutamate synthase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O33289 argA "Amino-acid acetyltransferase" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2061 GSU_2061 "acetyltransferase, GNAT family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00010579001 | SubName- Full=Chromosome chr7 scaffold_270, whole genome shotgun sequence; (412 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00014587001 | • | • | • | • | 0.899 | ||||||
| GSVIVG00015101001 | • | • | • | 0.838 | |||||||
| GSVIVG00032389001 | • | • | • | • | • | 0.837 | |||||
| GSVIVG00036526001 | • | • | • | 0.821 | |||||||
| GSVIVG00017913001 | • | • | • | 0.745 | |||||||
| GSVIVG00023053001 | • | • | 0.641 | ||||||||
| GSVIVG00017199001 | • | 0.516 | |||||||||
| GSVIVG00034899001 | • | 0.484 | |||||||||
| GSVIVG00020486001 | • | • | 0.456 | ||||||||
| GSVIVG00027272001 | • | 0.440 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 366 | |||
| PLN02825 | 515 | PLN02825, PLN02825, amino-acid N-acetyltransferase | 0.0 | |
| PRK05279 | 441 | PRK05279, PRK05279, N-acetylglutamate synthase; Va | 4e-75 | |
| TIGR01890 | 429 | TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltran | 1e-61 | |
| COG1246 | 153 | COG1246, ArgA, N-acetylglutamate synthase and rela | 4e-39 | |
| cd04237 | 280 | cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylgluta | 2e-29 | |
| PRK07757 | 152 | PRK07757, PRK07757, acetyltransferase; Provisional | 2e-21 | |
| cd04237 | 280 | cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylgluta | 2e-17 | |
| PRK12308 | 614 | PRK12308, PRK12308, bifunctional argininosuccinate | 3e-17 | |
| PRK05279 | 441 | PRK05279, PRK05279, N-acetylglutamate synthase; Va | 9e-17 | |
| PRK07922 | 169 | PRK07922, PRK07922, N-acetylglutamate synthase; Va | 5e-15 | |
| pfam13508 | 79 | pfam13508, Acetyltransf_7, Acetyltransferase (GNAT | 5e-11 | |
| pfam00583 | 80 | pfam00583, Acetyltransf_1, Acetyltransferase (GNAT | 1e-10 | |
| cd04301 | 65 | cd04301, NAT_SF, N-Acyltransferase superfamily: Va | 2e-10 | |
| TIGR01890 | 429 | TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltran | 1e-09 | |
| COG0548 | 265 | COG0548, ArgB, Acetylglutamate kinase [Amino acid | 3e-09 | |
| PRK00942 | 283 | PRK00942, PRK00942, acetylglutamate kinase; Provis | 2e-08 | |
| cd04238 | 256 | cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L- | 3e-08 | |
| TIGR00761 | 231 | TIGR00761, argB, acetylglutamate kinase | 4e-08 | |
| COG0548 | 265 | COG0548, ArgB, Acetylglutamate kinase [Amino acid | 5e-08 | |
| cd04249 | 252 | cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glut | 6e-07 | |
| PRK04531 | 398 | PRK04531, PRK04531, acetylglutamate kinase; Provis | 4e-06 | |
| COG0456 | 177 | COG0456, RimI, Acetyltransferases [General functio | 6e-06 | |
| PRK00942 | 283 | PRK00942, PRK00942, acetylglutamate kinase; Provis | 3e-05 | |
| cd04238 | 256 | cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L- | 4e-05 | |
| pfam13673 | 118 | pfam13673, Acetyltransf_10, Acetyltransferase (GNA | 5e-05 | |
| cd04250 | 279 | cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutam | 5e-05 | |
| pfam13527 | 127 | pfam13527, Acetyltransf_9, Acetyltransferase (GNAT | 1e-04 | |
| cd04250 | 279 | cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutam | 2e-04 | |
| cd02169 | 297 | cd02169, Citrate_lyase_ligase, Citrate lyase ligas | 7e-04 | |
| TIGR01575 | 131 | TIGR01575, rimI, ribosomal-protein-alanine acetylt | 7e-04 | |
| pfam13420 | 154 | pfam13420, Acetyltransf_4, Acetyltransferase (GNAT | 0.002 |
| >gnl|CDD|215441 PLN02825, PLN02825, amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
Score = 649 bits (1677), Expect = 0.0
Identities = 283/355 (79%), Positives = 308/355 (86%), Gaps = 3/355 (0%)
Query: 1 MRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHL 60
++ERLD C+V+LSNLGYSSSGEVLNCNTYEVATACALAI ADKLICI+DGPILDE+G L
Sbjct: 162 IKERLDSNCIVLLSNLGYSSSGEVLNCNTYEVATACALAIGADKLICIVDGPILDENGRL 221
Query: 61 IRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERR 120
IRF+TL+EAD LIR+R KQSEIAANYVKAV ED + DS+ + + NG+ F
Sbjct: 222 IRFMTLEEADMLIRKRAKQSEIAANYVKAVGGEDYSYSLGLDSVNTTPFNNNGRGFWGSG 281
Query: 121 IAT--FNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLL 178
AT F NGVGFDNGNGL S EQGFAIGG+ERLSRLNGYLSELAAAAFVCR GVQRVHLL
Sbjct: 282 SATDSFQNGVGFDNGNGL-SGEQGFAIGGEERLSRLNGYLSELAAAAFVCRGGVQRVHLL 340
Query: 179 DGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDE 238
DGTI GVLLLELF RDGMGTM+ASD+YEGTR A+V DL+GI+QII+PL ESG LVRRTDE
Sbjct: 341 DGTIEGVLLLELFTRDGMGTMIASDMYEGTRMARVEDLAGIRQIIRPLEESGILVRRTDE 400
Query: 239 ELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKK 298
ELL+ALDSF VVEREG IIACAALFPFF+EKCGEVAAI VSPECRGQGQGDKLLDYIEKK
Sbjct: 401 ELLRALDSFVVVEREGSIIACAALFPFFEEKCGEVAAIAVSPECRGQGQGDKLLDYIEKK 460
Query: 299 AASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLL 353
AASLGL+ LFLLTTRTADWF RGF ECSIE +PE RRKRINLSR SKYYMKKLL
Sbjct: 461 AASLGLEKLFLLTTRTADWFVRRGFSECSIESLPEARRKRINLSRGSKYYMKKLL 515
|
Length = 515 |
| >gnl|CDD|235386 PRK05279, PRK05279, N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233620 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224167 COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239770 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts | Back alignment and domain information |
|---|
| >gnl|CDD|236088 PRK07757, PRK07757, acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239770 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts | Back alignment and domain information |
|---|
| >gnl|CDD|183425 PRK12308, PRK12308, bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235386 PRK05279, PRK05279, N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236132 PRK07922, PRK07922, N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family | Back alignment and domain information |
|---|
| >gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >gnl|CDD|233620 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223622 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234869 PRK00942, PRK00942, acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239771 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like | Back alignment and domain information |
|---|
| >gnl|CDD|233118 TIGR00761, argB, acetylglutamate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|223622 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239782 cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|235306 PRK04531, PRK04531, acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223532 COG0456, RimI, Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234869 PRK00942, PRK00942, acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239771 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like | Back alignment and domain information |
|---|
| >gnl|CDD|222309 pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239783 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|222199 pfam13527, Acetyltransf_9, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239783 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|173920 cd02169, Citrate_lyase_ligase, Citrate lyase ligase | Back alignment and domain information |
|---|
| >gnl|CDD|233477 TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|222116 pfam13420, Acetyltransf_4, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 366 | |||
| PLN02825 | 515 | amino-acid N-acetyltransferase | 100.0 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 100.0 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 100.0 | |
| COG0548 | 265 | ArgB Acetylglutamate kinase [Amino acid transport | 99.95 | |
| PRK04531 | 398 | acetylglutamate kinase; Provisional | 99.94 | |
| cd04236 | 271 | AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA | 99.91 | |
| cd04237 | 280 | AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) | 99.9 | |
| COG1246 | 153 | ArgA N-acetylglutamate synthase and related acetyl | 99.9 | |
| CHL00202 | 284 | argB acetylglutamate kinase; Provisional | 99.87 | |
| KOG2436 | 520 | consensus Acetylglutamate kinase/acetylglutamate s | 99.87 | |
| cd04252 | 248 | AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam | 99.86 | |
| PRK00942 | 283 | acetylglutamate kinase; Provisional | 99.84 | |
| PLN02512 | 309 | acetylglutamate kinase | 99.82 | |
| cd04250 | 279 | AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase | 99.82 | |
| cd04238 | 256 | AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate | 99.81 | |
| cd04249 | 252 | AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina | 99.79 | |
| cd04251 | 257 | AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina | 99.79 | |
| PRK14058 | 268 | acetylglutamate/acetylaminoadipate kinase; Provisi | 99.79 | |
| PRK12352 | 316 | putative carbamate kinase; Reviewed | 99.76 | |
| cd04241 | 252 | AAK_FomA-like AAK_FomA-like: This CD includes a fo | 99.72 | |
| TIGR00761 | 231 | argB acetylglutamate kinase. This model describes | 99.71 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 99.7 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 99.67 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 99.63 | |
| cd04242 | 251 | AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K | 99.63 | |
| cd02115 | 248 | AAK Amino Acid Kinases (AAK) superfamily, catalyti | 99.61 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 99.61 | |
| PRK12454 | 313 | carbamate kinase-like carbamoyl phosphate syntheta | 99.61 | |
| cd04256 | 284 | AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase | 99.6 | |
| COG0263 | 369 | ProB Glutamate 5-kinase [Amino acid transport and | 99.59 | |
| TIGR00746 | 310 | arcC carbamate kinase. The seed alignment for this | 99.58 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 99.58 | |
| PRK05429 | 372 | gamma-glutamyl kinase; Provisional | 99.57 | |
| PTZ00489 | 264 | glutamate 5-kinase; Provisional | 99.56 | |
| PRK09411 | 297 | carbamate kinase; Reviewed | 99.56 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 99.56 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 99.54 | |
| PRK13402 | 368 | gamma-glutamyl kinase; Provisional | 99.54 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 99.53 | |
| PRK12314 | 266 | gamma-glutamyl kinase; Provisional | 99.52 | |
| PRK12353 | 314 | putative amino acid kinase; Reviewed | 99.51 | |
| PRK12686 | 312 | carbamate kinase; Reviewed | 99.51 | |
| PF00696 | 242 | AA_kinase: Amino acid kinase family Match to Gluta | 99.51 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 99.5 | |
| KOG3216 | 163 | consensus Diamine acetyltransferase [Amino acid tr | 99.49 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 99.49 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 99.49 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 99.48 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 99.48 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 99.47 | |
| cd04235 | 308 | AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot | 99.47 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 99.47 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 99.46 | |
| TIGR01027 | 363 | proB glutamate 5-kinase. Bacterial ProB proteins h | 99.46 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 99.46 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 99.46 | |
| PRK12354 | 307 | carbamate kinase; Reviewed | 99.46 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 99.43 | |
| PLN02418 | 718 | delta-1-pyrroline-5-carboxylate synthase | 99.42 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 99.42 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 99.42 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 99.42 | |
| TIGR01092 | 715 | P5CS delta l-pyrroline-5-carboxylate synthetase. T | 99.41 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 99.4 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 99.39 | |
| KOG3139 | 165 | consensus N-acetyltransferase [General function pr | 99.37 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 99.37 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 99.36 | |
| KOG1154 | 285 | consensus Gamma-glutamyl kinase [Amino acid transp | 99.36 | |
| cd04246 | 239 | AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina | 99.33 | |
| cd04261 | 239 | AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina | 99.33 | |
| cd04240 | 203 | AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin | 99.32 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 99.32 | |
| cd04260 | 244 | AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase | 99.3 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 99.29 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 99.28 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 99.27 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 99.27 | |
| cd04255 | 262 | AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th | 99.26 | |
| cd04234 | 227 | AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK) | 99.24 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 99.24 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 99.24 | |
| PRK01346 | 411 | hypothetical protein; Provisional | 99.24 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 99.22 | |
| KOG3396 | 150 | consensus Glucosamine-phosphate N-acetyltransferas | 99.21 | |
| PHA01807 | 153 | hypothetical protein | 99.19 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 99.18 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 99.17 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 99.16 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 99.16 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 99.13 | |
| cd04239 | 229 | AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik | 99.12 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 99.07 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 99.05 | |
| PRK00358 | 231 | pyrH uridylate kinase; Provisional | 99.05 | |
| cd04244 | 298 | AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina | 99.05 | |
| TIGR02076 | 221 | pyrH_arch uridylate kinase, putative. This family | 99.02 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 98.99 | |
| COG0549 | 312 | ArcC Carbamate kinase [Amino acid transport and me | 98.98 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 98.98 | |
| cd04253 | 221 | AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP | 98.95 | |
| COG1608 | 252 | Predicted archaeal kinase [General function predic | 98.95 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 98.95 | |
| cd04254 | 231 | AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi | 98.94 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 98.9 | |
| PRK14558 | 231 | pyrH uridylate kinase; Provisional | 98.84 | |
| PRK08841 | 392 | aspartate kinase; Validated | 98.83 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 98.81 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 98.81 | |
| KOG3235 | 193 | consensus Subunit of the major N alpha-acetyltrans | 98.81 | |
| KOG2488 | 202 | consensus Acetyltransferase (GNAT) domain-containi | 98.8 | |
| TIGR02075 | 233 | pyrH_bact uridylate kinase. This protein, also cal | 98.8 | |
| COG2153 | 155 | ElaA Predicted acyltransferase [General function p | 98.76 | |
| KOG3397 | 225 | consensus Acetyltransferases [General function pre | 98.68 | |
| KOG3234 | 173 | consensus Acetyltransferase, (GNAT) family [Genera | 98.66 | |
| KOG3138 | 187 | consensus Predicted N-acetyltransferase [General f | 98.63 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 98.62 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 98.56 | |
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 98.51 | |
| TIGR02078 | 327 | AspKin_pair Pyrococcus aspartate kinase subunit, p | 98.47 | |
| PRK08373 | 341 | aspartate kinase; Validated | 98.46 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 98.45 | |
| PRK14557 | 247 | pyrH uridylate kinase; Provisional | 98.44 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 98.44 | |
| COG3981 | 174 | Predicted acetyltransferase [General function pred | 98.41 | |
| COG3818 | 167 | Predicted acetyltransferase, GNAT superfamily [Gen | 98.36 | |
| cd04259 | 295 | AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super | 98.34 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 98.31 | |
| cd04243 | 293 | AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kina | 98.3 | |
| PF13718 | 196 | GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z | 98.29 | |
| PRK14556 | 249 | pyrH uridylate kinase; Provisional | 98.25 | |
| PF04768 | 170 | DUF619: Protein of unknown function (DUF619); Inte | 98.03 | |
| cd04257 | 294 | AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa | 98.02 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 97.95 | |
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 97.92 | |
| cd04245 | 288 | AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Ki | 97.9 | |
| PRK05925 | 440 | aspartate kinase; Provisional | 97.9 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 97.85 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 97.84 | |
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 97.83 | |
| PRK08961 | 861 | bifunctional aspartate kinase/diaminopimelate deca | 97.79 | |
| COG4552 | 389 | Eis Predicted acetyltransferase involved in intrac | 97.74 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 97.73 | |
| cd04258 | 292 | AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Ki | 97.72 | |
| cd04247 | 306 | AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfa | 97.58 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 97.55 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 97.51 | |
| PF00765 | 182 | Autoind_synth: Autoinducer synthetase; InterPro: I | 97.4 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 97.32 | |
| KOG4144 | 190 | consensus Arylalkylamine N-acetyltransferase [Gene | 97.31 | |
| PF04958 | 342 | AstA: Arginine N-succinyltransferase beta subunit; | 97.31 | |
| TIGR03694 | 241 | exosort_acyl putative PEP-CTERM/exosortase system- | 97.26 | |
| KOG4135 | 185 | consensus Predicted phosphoglucosamine acetyltrans | 97.19 | |
| PRK10456 | 344 | arginine succinyltransferase; Provisional | 97.09 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 97.08 | |
| PF13480 | 142 | Acetyltransf_6: Acetyltransferase (GNAT) domain | 97.01 | |
| PRK13834 | 207 | putative autoinducer synthesis protein; Provisiona | 97.0 | |
| TIGR03244 | 336 | arg_catab_AstA arginine N-succinyltransferase. In | 96.77 | |
| COG2054 | 212 | Uncharacterized archaeal kinase related to asparto | 96.75 | |
| TIGR03245 | 336 | arg_AOST_alph arginine/ornithine succinyltransfera | 96.68 | |
| TIGR03243 | 335 | arg_catab_AOST arginine and ornithine succinyltran | 96.61 | |
| COG5628 | 143 | Predicted acetyltransferase [General function pred | 96.5 | |
| PF06852 | 181 | DUF1248: Protein of unknown function (DUF1248); In | 96.5 | |
| COG0528 | 238 | PyrH Uridylate kinase [Nucleotide transport and me | 96.49 | |
| cd04248 | 304 | AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase S | 96.46 | |
| COG3916 | 209 | LasI N-acyl-L-homoserine lactone synthetase [Signa | 96.26 | |
| PRK09181 | 475 | aspartate kinase; Validated | 96.14 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 96.12 | |
| KOG2036 | 1011 | consensus Predicted P-loop ATPase fused to an acet | 95.98 | |
| COG1243 | 515 | ELP3 Histone acetyltransferase [Transcription / Ch | 95.72 | |
| PLN02551 | 521 | aspartokinase | 95.54 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 95.28 | |
| PF13880 | 70 | Acetyltransf_13: ESCO1/2 acetyl-transferase | 95.02 | |
| COG3138 | 336 | AstA Arginine/ornithine N-succinyltransferase beta | 94.89 | |
| PF01853 | 188 | MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i | 94.4 | |
| cd04264 | 99 | DUF619-NAGS DUF619 domain of various N-acetylgluta | 94.12 | |
| COG5630 | 495 | ARG2 Acetylglutamate synthase [Amino acid transpor | 93.55 | |
| cd04265 | 99 | DUF619-NAGS-U DUF619 domain of various N-acetylglu | 93.02 | |
| TIGR03019 | 330 | pepcterm_femAB FemAB-related protein, PEP-CTERM sy | 92.86 | |
| PLN03238 | 290 | probable histone acetyltransferase MYST; Provision | 92.69 | |
| KOG2535 | 554 | consensus RNA polymerase II elongator complex, sub | 92.47 | |
| COG3375 | 266 | Uncharacterized conserved protein [Function unknow | 91.72 | |
| PF02799 | 190 | NMT_C: Myristoyl-CoA:protein N-myristoyltransferas | 91.63 | |
| PTZ00064 | 552 | histone acetyltransferase; Provisional | 91.31 | |
| PF04377 | 128 | ATE_C: Arginine-tRNA-protein transferase, C termin | 91.25 | |
| PLN03239 | 351 | histone acetyltransferase; Provisional | 91.15 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 90.66 | |
| PRK01305 | 240 | arginyl-tRNA-protein transferase; Provisional | 90.08 | |
| KOG2747 | 396 | consensus Histone acetyltransferase (MYST family) | 89.98 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 89.75 | |
| PLN00104 | 450 | MYST -like histone acetyltransferase; Provisional | 89.37 | |
| KOG2779 | 421 | consensus N-myristoyl transferase [Lipid transport | 89.15 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 88.55 | |
| PF12261 | 179 | T_hemolysin: Thermostable hemolysin; InterPro: IPR | 88.21 | |
| PF01233 | 162 | NMT: Myristoyl-CoA:protein N-myristoyltransferase, | 87.07 | |
| PF13444 | 101 | Acetyltransf_5: Acetyltransferase (GNAT) domain | 85.35 | |
| PF09390 | 161 | DUF1999: Protein of unknown function (DUF1999); In | 84.8 | |
| PF09924 | 299 | DUF2156: Uncharacterized conserved protein (DUF215 | 84.59 | |
| PF05301 | 120 | Mec-17: Touch receptor neuron protein Mec-17; Inte | 82.84 |
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=9e-65 Score=510.36 Aligned_cols=347 Identities=81% Similarity=1.256 Sum_probs=312.7
Q ss_pred CcccccCCceEEEcCcccCCCCCeeecCHHHHHHHHHHHcCCCEEEEEecCcccccCCcccccCCHHHHHHHHHHhhhhh
Q 017745 1 MRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQS 80 (366)
Q Consensus 1 i~~ll~~g~ipvi~~~g~~~~g~~~nin~D~~A~~~A~al~a~kLi~ltd~~~~~~~~~~i~~l~~~~~~~l~~~~~~~~ 80 (366)
|+++|++|.||||+|+|+|++|++||||+|++|+++|.+|+|+|||||||+++++.+|++|++|+++|++++++++.+|+
T Consensus 162 i~~~L~~g~Ipvisplg~s~~Ge~~NinaD~vA~avA~aL~A~KLI~ltd~~~~~~~g~li~~l~~~e~~~li~~~~~~~ 241 (515)
T PLN02825 162 IKERLDSNCIVLLSNLGYSSSGEVLNCNTYEVATACALAIGADKLICIVDGPILDENGRLIRFMTLEEADMLIRKRAKQS 241 (515)
T ss_pred HHHHHhCCCeEEECCceECCCCCEEeeCHHHHHHHHHHHcCCCeEEEEeCcceecCCCCCcCcCCHHHHHHHHHhhhhcc
Confidence 56899999999999999999999999999999999999999999999999999899999999999999999998777788
Q ss_pred HHHHhHHhhhhccccccccCCCCCC-----ccccCCCCCcc--chhhhhhccCCCccCCCCCCcccccccccccchhhhh
Q 017745 81 EIAANYVKAVAEEDITCFGHSDSIG-----SVYSSQNGKTF--SERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSR 153 (366)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 153 (366)
.+||++.+|+++++.+ .+.+ ..+++.++..+ +-++...|.++.+++++.|. ...++|+.++.+++++
T Consensus 242 ~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~ 315 (515)
T PLN02825 242 EIAANYVKAVGGEDYS-----YSLGLDSVNTTPFNNNGRGFWGSGSATDSFQNGVGFDNGNGL-SGEQGFAIGGEERLSR 315 (515)
T ss_pred hhhhhhhhhccccccc-----cccccccccccccccccccccccccccccccccccccCcccc-cccccccccchhhchh
Confidence 8999999999988622 2221 22222222222 12344456666667665553 5679999999999999
Q ss_pred ccccHHHHHHHHHHHHcCCceEEeeccccCcchhhhhhhcCCCccccccCccceEEeCcccCHHHHHHHHHHHHHcCcCc
Q 017745 154 LNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALV 233 (366)
Q Consensus 154 ~~~~~~~l~~A~~al~~Gv~rv~iv~g~~~~~ll~elfs~~g~gTmi~~d~~~~iR~a~~~Di~~i~~L~~~~~~~~~~~ 233 (366)
...+.++|.+|+.||+.||+|+|+++++.+++|+.||||++|+||||+.++|..||+++.+|++.|.+|+++....++..
T Consensus 316 ~~~~~~~l~~a~~a~~~gv~r~hl~~~~~~gall~elft~dg~gt~i~~~~~e~IR~At~eDi~~I~~Li~~lee~g~lv 395 (515)
T PLN02825 316 LNGYLSELAAAAFVCRGGVQRVHLLDGTIEGVLLLELFTRDGMGTMIASDMYEGTRMARVEDLAGIRQIIRPLEESGILV 395 (515)
T ss_pred hhhHHHHHHHHHHHHHcCCCeEEeccCCCCchHHHHhhccCCceeEeccChHhhheeCCHHHHHHHHHHHHHHHHcCCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999988888
Q ss_pred cCCHHHHHhccCcEEEEEECCEEEEEEEEeeecCCCeEEEEEEEEccCCcCCcHHHHHHHHHHHHHHHcCCCEEEEEeHH
Q 017745 234 RRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTR 313 (366)
Q Consensus 234 ~~~~e~l~~~~~~~~v~~~dg~iVG~~~l~~~~~~~~~~L~~l~V~p~~RgqGiG~~Ll~~l~~~a~~~g~~~v~l~t~~ 313 (366)
.++++.+..++..|++++.||+++||+.+.++.+...++|.+++|+|+|||+|+|++||++++++|+++|++.+++.+++
T Consensus 396 ~rs~e~le~ei~~f~V~e~Dg~IVG~aal~~~~~~~~aEI~~laV~P~yRGkGiG~~LL~~le~~Ar~~G~~~L~Lltt~ 475 (515)
T PLN02825 396 RRTDEELLRALDSFVVVEREGSIIACAALFPFFEEKCGEVAAIAVSPECRGQGQGDKLLDYIEKKAASLGLEKLFLLTTR 475 (515)
T ss_pred CCCHHHHHhcCCcEEEEEECCEEEEEEEEEeecCCCcEEEEEEEECHHHcCCCHHHHHHHHHHHHHHHCCCCEEEEEeCc
Confidence 89999999999999999999999999999987777789999999999999999999999999999999999999999999
Q ss_pred HHHHHHhCCCeEeccccccHHHHhhhcCCCCceeEEeecC
Q 017745 314 TADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLL 353 (366)
Q Consensus 314 a~~~Y~klGF~~~g~~~lp~~~~~~y~~~r~s~vl~k~L~ 353 (366)
+.+||+|+||+..+.+.+|..|+..||++|+|++|+|.|.
T Consensus 476 a~~fY~k~GF~~~~~~~lp~~~~~~yn~~r~sk~~~k~l~ 515 (515)
T PLN02825 476 TADWFVRRGFSECSIESLPEARRKRINLSRGSKYYMKKLL 515 (515)
T ss_pred HHHHHHHCCCEEeChhhCCHHHHhhcCccCCcEEEEEecC
Confidence 9999999999999999999999999999999999999983
|
|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04531 acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals | Back alignment and domain information |
|---|
| >cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts | Back alignment and domain information |
|---|
| >COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00202 argB acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2436 consensus Acetylglutamate kinase/acetylglutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) | Back alignment and domain information |
|---|
| >PRK00942 acetylglutamate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02512 acetylglutamate kinase | Back alignment and domain information |
|---|
| >cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like | Back alignment and domain information |
|---|
| >cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis | Back alignment and domain information |
|---|
| >cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) | Back alignment and domain information |
|---|
| >PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12352 putative carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms | Back alignment and domain information |
|---|
| >TIGR00761 argB acetylglutamate kinase | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis | Back alignment and domain information |
|---|
| >COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00746 arcC carbamate kinase | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05429 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00489 glutamate 5-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09411 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >PRK13402 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12314 gamma-glutamyl kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12353 putative amino acid kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK12686 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01027 proB glutamate 5-kinase | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >PRK12354 carbamate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >PLN02418 delta-1-pyrroline-5-carboxylate synthase | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG3139 consensus N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1154 consensus Gamma-glutamyl kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes | Back alignment and domain information |
|---|
| >cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences | Back alignment and domain information |
|---|
| >cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >PRK00358 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants | Back alignment and domain information |
|---|
| >TIGR02076 pyrH_arch uridylate kinase, putative | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >COG1608 Predicted archaeal kinase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14558 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08841 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02075 pyrH_bact uridylate kinase | Back alignment and domain information |
|---|
| >COG2153 ElaA Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3397 consensus Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative | Back alignment and domain information |
|---|
| >PRK08373 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14557 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >COG3981 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B | Back alignment and domain information |
|---|
| >PRK14556 pyrH uridylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2 | Back alignment and domain information |
|---|
| >cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species | Back alignment and domain information |
|---|
| >PRK05925 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional | Back alignment and domain information |
|---|
| >COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine | Back alignment and domain information |
|---|
| >TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase | Back alignment and domain information |
|---|
| >KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10456 arginine succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >PRK13834 putative autoinducer synthesis protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03244 arg_catab_AstA arginine N-succinyltransferase | Back alignment and domain information |
|---|
| >COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits | Back alignment and domain information |
|---|
| >COG5628 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria | Back alignment and domain information |
|---|
| >COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase | Back alignment and domain information |
|---|
| >COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus | Back alignment and domain information |
|---|
| >cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish | Back alignment and domain information |
|---|
| >COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish | Back alignment and domain information |
|---|
| >TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated | Back alignment and domain information |
|---|
| >PLN03238 probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >COG3375 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02799 NMT_C: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain; InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >PTZ00064 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein | Back alignment and domain information |
|---|
| >PLN03239 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01305 arginyl-tRNA-protein transferase; Provisional | Back alignment and domain information |
|---|
| >KOG2747 consensus Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PLN00104 MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2779 consensus N-myristoyl transferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12261 T_hemolysin: Thermostable hemolysin; InterPro: IPR022050 This family of proteins is found in bacteria | Back alignment and domain information |
|---|
| >PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >PF09390 DUF1999: Protein of unknown function (DUF1999); InterPro: IPR018987 This family contains a putative Fe-S binding reductase (Q72J89 from SWISSPROT) whose structure adopts an alpha and beta fold | Back alignment and domain information |
|---|
| >PF09924 DUF2156: Uncharacterized conserved protein (DUF2156); InterPro: IPR024320 This domain of unknown function is found in uncharacterised proteins and in Lysylphosphatidylglycerol synthetase, which catalyses the transfer of a lysyl group from L-lysyl-tRNA(Lys) to membrane-bound phosphatidylglycerol [] | Back alignment and domain information |
|---|
| >PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 366 | ||||
| 2r8v_A | 456 | Native Structure Of N-Acetylglutamate Synthase From | 8e-35 | ||
| 2r98_A | 456 | Crystal Structure Of N-Acetylglutamate Synthase (Se | 9e-35 | ||
| 3e0k_A | 150 | Crystal Structure Of C-Termianl Domain Of N-Acetylg | 6e-26 | ||
| 2gan_A | 190 | Crystal Structure Of A Putative Acetyltransferase F | 4e-04 |
| >pdb|2R8V|A Chain A, Native Structure Of N-Acetylglutamate Synthase From Neisseria Gonorrhoeae Length = 456 | Back alignment and structure |
|
| >pdb|3E0K|A Chain A, Crystal Structure Of C-Termianl Domain Of N-Acetylglutamate Synthase From Vibrio Parahaemolyticus Length = 150 | Back alignment and structure |
| >pdb|2GAN|A Chain A, Crystal Structure Of A Putative Acetyltransferase From Pyrococcus Horikoshii, Northeast Structural Genomics Target Jr32. Length = 190 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 366 | |||
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 1e-83 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 5e-18 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 1e-54 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 4e-22 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 8e-15 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 6e-14 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 6e-14 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 1e-13 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 2e-13 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 2e-13 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 1e-12 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 1e-12 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 2e-12 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 5e-12 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 2e-11 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 2e-11 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 2e-11 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 3e-11 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 3e-11 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 3e-11 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 4e-11 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 5e-11 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 6e-11 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 8e-11 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 1e-10 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 1e-10 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 2e-10 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 2e-10 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 3e-10 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 3e-10 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 4e-10 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 5e-10 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 6e-10 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 9e-10 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 1e-09 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 1e-09 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 2e-09 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 2e-09 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 2e-09 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 2e-09 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 3e-09 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 4e-09 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 5e-09 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 7e-09 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 8e-09 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 8e-09 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 8e-09 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 9e-09 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 1e-08 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 1e-08 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 1e-08 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 1e-08 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 2e-08 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 2e-08 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 2e-08 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 2e-08 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 3e-08 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 3e-08 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 3e-08 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 4e-08 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 4e-08 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 4e-08 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 4e-08 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 4e-08 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 5e-08 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 6e-08 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 7e-08 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 9e-08 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 2e-07 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 2e-07 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 2e-07 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 3e-07 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 3e-07 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 4e-07 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 5e-07 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 5e-07 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 8e-07 | |
| 3s6k_A | 467 | Acetylglutamate kinase; synthase, transferase; 2.8 | 9e-07 | |
| 3s6k_A | 467 | Acetylglutamate kinase; synthase, transferase; 2.8 | 5e-04 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 1e-06 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 1e-06 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 1e-06 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 2e-06 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 2e-06 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 1e-04 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 2e-06 | |
| 2buf_A | 300 | Acetylglutamate kinase; acetyglutamate kinase, ADP | 2e-06 | |
| 2buf_A | 300 | Acetylglutamate kinase; acetyglutamate kinase, ADP | 2e-05 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 2e-06 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 3e-06 | |
| 2v5h_A | 321 | Acetylglutamate kinase; amino-acid biosynthesis, t | 3e-06 | |
| 2v5h_A | 321 | Acetylglutamate kinase; amino-acid biosynthesis, t | 5e-05 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 3e-06 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 5e-06 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 6e-06 | |
| 2ap9_A | 299 | NAG kinase, acetylglutamate kinase, AGK; structura | 7e-06 | |
| 2ap9_A | 299 | NAG kinase, acetylglutamate kinase, AGK; structura | 6e-05 | |
| 2bty_A | 282 | Acetylglutamate kinase; N-acetyl-L-glutamate kinas | 8e-06 | |
| 2bty_A | 282 | Acetylglutamate kinase; N-acetyl-L-glutamate kinas | 7e-05 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 8e-06 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 1e-05 | |
| 2rd5_A | 298 | Acetylglutamate kinase-like protein; protein-prote | 1e-05 | |
| 2rd5_A | 298 | Acetylglutamate kinase-like protein; protein-prote | 5e-05 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 2e-05 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 3e-05 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 4e-05 | |
| 4ab7_A | 464 | Protein Arg5,6, mitochondrial; transferase, argini | 4e-05 | |
| 4ab7_A | 464 | Protein Arg5,6, mitochondrial; transferase, argini | 7e-05 | |
| 3l86_A | 279 | Acetylglutamate kinase; ARGB, amino-acid biosynthe | 4e-05 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 5e-05 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 5e-05 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 6e-05 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 6e-05 | |
| 1gs5_A | 258 | Acetylglutamate kinase; carbamate kinase, amino ac | 7e-05 | |
| 3zzh_A | 307 | Acetylglutamate kinase; transferase, arginine bios | 9e-05 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 1e-04 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 1e-04 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 2e-04 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 3e-04 | |
| 2egx_A | 269 | Putative acetylglutamate kinase; struc genomics, N | 3e-04 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 4e-04 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 4e-04 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 5e-04 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 7e-04 |
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 | Back alignment and structure |
|---|
Score = 260 bits (667), Expect = 1e-83
Identities = 74/193 (38%), Positives = 113/193 (58%), Gaps = 1/193 (0%)
Query: 161 LAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIK 220
+++A GV RV +L+G G LL ELF R+G+GT +A + + R A D+ I
Sbjct: 262 ISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHIA 321
Query: 221 QIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSP 280
+I+PL E G L+ R+ E L + F ++E +G + CAAL F + CGE+A + VSP
Sbjct: 322 ALIRPLEEQGILLHRSREYLENHISEFSILEHDGNLYGCAALKTFAEADCGEIACLAVSP 381
Query: 281 ECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRIN 340
+ + G G++LL +I KA +G+ LF L+T T +WF RGF+ S + +PE RRK
Sbjct: 382 QAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFAERGFQTASEDELPETRRKDYR 441
Query: 341 LS-RNSKYYMKKL 352
+ RNS +++L
Sbjct: 442 SNGRNSHILVRRL 454
|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456 | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Length = 163 | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Length = 181 | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168 | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Length = 166 | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172 | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Length = 164 | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190 | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Length = 162 | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 159 | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Length = 150 | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Length = 161 | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140 | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 162 | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 406 | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166 | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 166 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Length = 170 | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 152 | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165 | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Length = 150 | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Length = 177 | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Length = 160 | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Length = 388 | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149 | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Length = 157 | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 228 | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Length = 182 | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153 | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254 | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Length = 396 | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} PDB: 3dr8_A* Length = 174 | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Length = 176 | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Length = 172 | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Length = 144 | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 400 | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Length = 288 | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Length = 187 | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Length = 184 | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Length = 160 | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Length = 142 | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133 | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Length = 179 | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 175 | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Length = 170 | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 199 | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Length = 180 | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169 | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Length = 165 | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Length = 175 | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Length = 183 | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Length = 143 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 164 | Back alignment and structure |
|---|
| >3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Length = 467 | Back alignment and structure |
|---|
| >3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Length = 467 | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Length = 153 | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Length = 172 | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 159 | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Length = 197 | Back alignment and structure |
|---|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Length = 460 | Back alignment and structure |
|---|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Length = 460 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 | Back alignment and structure |
|---|
| >2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Length = 300 | Back alignment and structure |
|---|
| >2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Length = 300 | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160 | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Length = 181 | Back alignment and structure |
|---|
| >2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Length = 321 | Back alignment and structure |
|---|
| >2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Length = 321 | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Length = 168 | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Length = 182 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Length = 174 | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312 | Back alignment and structure |
|---|
| >2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 Length = 299 | Back alignment and structure |
|---|
| >2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 Length = 299 | Back alignment and structure |
|---|
| >2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Length = 282 | Back alignment and structure |
|---|
| >2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Length = 282 | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Length = 140 | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Length = 207 | Back alignment and structure |
|---|
| >2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Length = 298 | Back alignment and structure |
|---|
| >2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Length = 298 | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Length = 166 | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} Length = 163 | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Length = 276 | Back alignment and structure |
|---|
| >4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Length = 464 | Back alignment and structure |
|---|
| >4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Length = 464 | Back alignment and structure |
|---|
| >3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans} Length = 279 | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Length = 201 | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Length = 147 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Length = 189 | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Length = 147 | Back alignment and structure |
|---|
| >1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A* Length = 258 | Back alignment and structure |
|---|
| >3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A* Length = 307 | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Length = 188 | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Length = 422 | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} Length = 428 | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Length = 224 | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Length = 171 | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Length = 197 | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Length = 170 | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Length = 166 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 366 | |||
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 100.0 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 99.97 | |
| 3s6k_A | 467 | Acetylglutamate kinase; synthase, transferase; 2.8 | 99.96 | |
| 4ab7_A | 464 | Protein Arg5,6, mitochondrial; transferase, argini | 99.94 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 99.91 | |
| 2v5h_A | 321 | Acetylglutamate kinase; amino-acid biosynthesis, t | 99.85 | |
| 2ap9_A | 299 | NAG kinase, acetylglutamate kinase, AGK; structura | 99.84 | |
| 2rd5_A | 298 | Acetylglutamate kinase-like protein; protein-prote | 99.84 | |
| 2buf_A | 300 | Acetylglutamate kinase; acetyglutamate kinase, ADP | 99.84 | |
| 2bty_A | 282 | Acetylglutamate kinase; N-acetyl-L-glutamate kinas | 99.82 | |
| 3ll9_A | 269 | Isopentenyl phosphate kinase; mevalonate biosynthe | 99.81 | |
| 3l86_A | 279 | Acetylglutamate kinase; ARGB, amino-acid biosynthe | 99.79 | |
| 3zzh_A | 307 | Acetylglutamate kinase; transferase, arginine bios | 99.79 | |
| 3k4o_A | 266 | Isopentenyl phosphate kinase; small molecule kinas | 99.79 | |
| 1gs5_A | 258 | Acetylglutamate kinase; carbamate kinase, amino ac | 99.78 | |
| 2egx_A | 269 | Putative acetylglutamate kinase; struc genomics, N | 99.77 | |
| 2we5_A | 310 | Carbamate kinase 1; arginine catabolism, arginine | 99.75 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 99.75 | |
| 2e9y_A | 316 | Carbamate kinase; transferase, structural genomics | 99.73 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 99.73 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 99.73 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 99.73 | |
| 3kzf_A | 317 | Carbamate kinase; arginine dihydrolase pathway, gi | 99.73 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 99.72 | |
| 2j5v_A | 367 | Glutamate 5-kinase; proline biosynthesis, gamma gl | 99.71 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 99.71 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 99.71 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 99.71 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 99.71 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 99.71 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 99.71 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 99.71 | |
| 3d40_A | 286 | FOMA protein; fosfomycin, antibiotic resistance, k | 99.7 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 99.7 | |
| 1e19_A | 314 | Carbamate kinase-like carbamoylphosphate synthetas | 99.7 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 99.7 | |
| 2ako_A | 251 | Glutamate 5-kinase; structural genomics, PSI, prot | 99.7 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 99.7 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 99.69 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 99.69 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 99.69 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 99.69 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 99.68 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 99.68 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 99.68 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 99.68 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 99.68 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 99.68 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 99.68 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 99.67 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 99.67 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 99.67 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 99.67 | |
| 3ll5_A | 249 | Gamma-glutamyl kinase related protein; alternate m | 99.67 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 99.67 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 99.67 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 99.67 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 99.66 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 99.66 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 99.66 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 99.66 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 99.65 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 99.65 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 99.65 | |
| 4axs_A | 332 | Carbamate kinase; oxidoreductase; 2.50A {Mycoplasm | 99.65 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 99.65 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 99.65 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 99.65 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 99.65 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 99.65 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 99.64 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 99.64 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 99.64 | |
| 2j4j_A | 226 | Uridylate kinase; transferase, nucleoside monophos | 99.64 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 99.64 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 99.63 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 99.63 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 99.63 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 99.63 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 99.63 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 99.63 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 99.62 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 99.62 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 99.62 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 99.62 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 99.62 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 99.62 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 99.62 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 99.61 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 99.61 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 99.61 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 99.61 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 99.61 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 99.61 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 99.6 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 99.6 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 99.6 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 99.6 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 99.6 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 99.59 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 99.59 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 99.59 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 99.59 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 99.59 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 99.59 | |
| 2ij9_A | 219 | Uridylate kinase; structural genomics, protein str | 99.59 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 99.59 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 99.59 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 99.58 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 99.58 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 99.58 | |
| 2brx_A | 244 | Uridylate kinase; UMP kinase, amino acid kinase, p | 99.58 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 99.57 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 99.57 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 99.57 | |
| 2ogx_B | 270 | Molybdenum storage protein subunit beta; open alph | 99.57 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 99.57 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 99.57 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 99.56 | |
| 4a7w_A | 240 | Uridylate kinase; transferase; HET: GTP; 1.80A {He | 99.56 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 99.56 | |
| 2ogx_A | 276 | Molybdenum storage protein subunit alpha; open alp | 99.56 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 99.55 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 99.55 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 99.55 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 99.55 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 99.55 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 99.55 | |
| 1z9d_A | 252 | Uridylate kinase, UK, UMP kinase; structural genom | 99.55 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 99.54 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 99.54 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 99.54 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 99.54 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 99.54 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 99.54 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 99.54 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 99.53 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 99.53 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 99.53 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 99.53 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 99.52 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 99.52 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 99.52 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 99.5 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 99.49 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 99.49 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 99.49 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 99.48 | |
| 3ek6_A | 243 | Uridylate kinase; UMPK unique GTP B site, alloster | 99.48 | |
| 2va1_A | 256 | Uridylate kinase; UMPK, transferase, pyrimidine bi | 99.47 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 99.47 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 99.47 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 99.47 | |
| 2a1f_A | 247 | Uridylate kinase; PYRH, structural genomics, PSI, | 99.46 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 99.46 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 99.45 | |
| 1ybd_A | 239 | Uridylate kinase; alpha/beta/alpha fold, hexamer, | 99.45 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 99.45 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 99.44 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 99.44 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 99.43 | |
| 3nwy_A | 281 | Uridylate kinase; allosterically activated form, A | 99.43 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 99.42 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 99.42 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 99.42 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 99.41 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 99.41 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 99.41 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 99.4 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 99.39 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 99.39 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 99.39 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 99.39 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 99.38 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 99.38 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 99.36 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 99.35 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 99.35 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 99.34 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 99.31 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 99.31 | |
| 2jjx_A | 255 | Uridylate kinase, UMP kinase; structural genomics, | 99.29 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 99.27 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 99.23 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 99.2 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 99.19 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 99.18 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 99.18 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 99.13 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 99.06 | |
| 2j0w_A | 449 | Lysine-sensitive aspartokinase 3; feedback inhibit | 99.0 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 98.95 | |
| 1ro5_A | 201 | Autoinducer synthesis protein LASI; alpha-beta-alp | 98.94 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 98.88 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 98.87 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 98.72 | |
| 3p2h_A | 201 | AHL synthase; acyl-ACP binding, SAM binding, signa | 98.69 | |
| 3shp_A | 176 | Putative acetyltransferase STHE_0691; PSI-biology, | 98.67 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 98.64 | |
| 1kzf_A | 230 | Acyl-homoserinelactone synthase ESAI; alpha-beta, | 98.48 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 98.45 | |
| 1yle_A | 342 | Arginine N-succinyltransferase, alpha chain; struc | 98.29 | |
| 3dns_A | 135 | Ribosomal-protein-alanine acetyltransferase; N-ter | 98.24 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 96.51 | |
| 2p0w_A | 324 | Histone acetyltransferase type B catalytic subuni; | 96.06 | |
| 4hkf_A | 191 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 94.26 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 94.08 | |
| 4b5o_A | 200 | Alpha-tubulin N-acetyltransferase; microtubules, c | 93.61 | |
| 3to7_A | 276 | Histone acetyltransferase ESA1; MYST family; HET: | 93.32 | |
| 3gkr_A | 336 | FEMX; FEMX, peptidoglycan, hexapeptide, transferas | 92.97 | |
| 2ozu_A | 284 | Histone acetyltransferase MYST3; structural genomi | 92.96 | |
| 2ou2_A | 280 | Histone acetyltransferase htatip; structural genom | 92.56 | |
| 4gs4_A | 240 | Alpha-tubulin N-acetyltransferase; acetyl coenzyme | 91.22 | |
| 4h6u_A | 200 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 91.01 | |
| 2pq8_A | 278 | Probable histone acetyltransferase MYST1; MOF, str | 90.94 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 90.12 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 89.74 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 89.66 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 89.22 | |
| 1lrz_A | 426 | FEMA, factor essential for expression of methicill | 86.14 | |
| 1iic_A | 422 | Peptide N-myristoyltransferase; HET: MYA; 2.20A {S | 85.66 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 85.46 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 85.28 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 84.15 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 83.74 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 82.74 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 81.17 | |
| 1iic_A | 422 | Peptide N-myristoyltransferase; HET: MYA; 2.20A {S | 80.87 |
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.5e-45 Score=369.19 Aligned_cols=276 Identities=35% Similarity=0.608 Sum_probs=255.6
Q ss_pred CcccccCCceEEEcCcccCCCCCeeecCHHHHHHHHHHHcCCCEEEEEecCccc-ccCCcccccCCHHHHHHHHHHhhhh
Q 017745 1 MRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPIL-DESGHLIRFLTLQEADSLIRQRVKQ 79 (366)
Q Consensus 1 i~~ll~~g~ipvi~~~g~~~~g~~~nin~D~~A~~~A~al~a~kLi~ltd~~~~-~~~~~~i~~l~~~~~~~l~~~~~~~ 79 (366)
|+++|++|.|||++|++.+++|+++|+|+|++|+.+|.+|+||+|||||||+++ +.++++|++++..++++++..+.
T Consensus 178 i~~lL~~g~ipIi~~~~~~~~g~~~~~~~D~~Aa~lA~~l~Ad~li~lTdvdGv~~~~~~~i~~i~~~e~~~~~~~g~-- 255 (456)
T 3d2m_A 178 LRFQLDAGNIVWMPPLGHSYGGKTFNLDMVQAAASVAVSLQAEKLVYLTLSDGISRPDGTLAETLSAQEAQSLAEHAA-- 255 (456)
T ss_dssp HHHHHHTTCEEEECSEEECTTSCEEECCHHHHHHHHHHHHTCSEEEEEESSSSCBCTTSCBCSEEEHHHHHHHHTTCC--
T ss_pred HHHHHHCCCeEEECCcccCCCCCEEEECHHHHHHHHHHHcCCCEEEEEECCccccCCCCCccccCCHHHHHHHHhccC--
Confidence 357999999999999999999999999999999999999999999999999965 56899999999999887753211
Q ss_pred hHHHHhHHhhhhccccccccCCCCCCccccCCCCCccchhhhhhccCCCccCCCCCCcccccccccccchhhhhccccHH
Q 017745 80 SEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLS 159 (366)
Q Consensus 80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 159 (366)
|| |.+
T Consensus 256 ------------------------------------------------------------------gg---------m~~ 260 (456)
T 3d2m_A 256 ------------------------------------------------------------------SE---------TRR 260 (456)
T ss_dssp ------------------------------------------------------------------HH---------HHH
T ss_pred ------------------------------------------------------------------CC---------hHH
Confidence 22 999
Q ss_pred HHHHHHHHHHcCCceEEeeccccCcchhhhhhhcCCCccccccCccceEEeCcccCHHHHHHHHHHHHHcCcCccCCHHH
Q 017745 160 ELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEE 239 (366)
Q Consensus 160 ~l~~A~~al~~Gv~rv~iv~g~~~~~ll~elfs~~g~gTmi~~d~~~~iR~a~~~Di~~i~~L~~~~~~~~~~~~~~~e~ 239 (366)
||.+|..|+..|+++++|++++.++.++.++|+..+.||+|.++.++.||+++++|++.+.+++.......+..+++.+.
T Consensus 261 Kl~aa~~a~~~gv~~v~I~~~~~~~~ll~~l~~~~~~GT~i~~~~~~~IR~a~~~D~~~i~~l~~~~~~~~~~~~~~~~~ 340 (456)
T 3d2m_A 261 LISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHIAALIRPLEEQGILLHRSREY 340 (456)
T ss_dssp HHHHHHHHHHTTCSEEEEEETTSTTHHHHHHHCSSCSSEEEECCCCCEEEECCGGGHHHHHHHHHHHHHHTSSCCCCHHH
T ss_pred HHHHHHHHHHhCCCEEEEecCcCCchHHHHHHhhcCCceeeecccceeeCCCCHHHHHHHHHHHHHHHhcCCCccCCHHH
Confidence 99999999999999999999999999889999999999999999999999999999999999999887777778889999
Q ss_pred HHhccCcEEEEEECCEEEEEEEEeeecCCCeEEEEEEEEccCCcCCcHHHHHHHHHHHHHHHcCCCEEEEEeHHHHHHHH
Q 017745 240 LLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFK 319 (366)
Q Consensus 240 l~~~~~~~~v~~~dg~iVG~~~l~~~~~~~~~~L~~l~V~p~~RgqGiG~~Ll~~l~~~a~~~g~~~v~l~t~~a~~~Y~ 319 (366)
+...+..+++++.+++++||+.+....+...++|..++|+|+|||+|+|++|++++++++++.|++.+++.++.+.+||+
T Consensus 341 ~~~~l~~~~va~~~g~iVG~~~~~~~~~~~~~~I~~l~V~p~~rg~GiG~~Ll~~~~~~a~~~g~~~i~l~N~~a~~fY~ 420 (456)
T 3d2m_A 341 LENHISEFSILEHDGNLYGCAALKTFAEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFA 420 (456)
T ss_dssp HHHHGGGEEEEEETTEEEEEEEEEECSSTTEEEEEEEEECGGGTTSSHHHHHHHHHHHHHHHTTCCEEEEEESSCHHHHH
T ss_pred HHHHHhhEEEEEECCEEEEEEEEEecCCCCEEEEEEEEECHHHcCCCHHHHHHHHHHHHHHHcCCCEEEEEcHHHHHHHH
Confidence 99888889999999999999999976566789999999999999999999999999999999999999998888999999
Q ss_pred hCCCeEeccccccHHHHhhhcCC-CCceeEEeecC
Q 017745 320 SRGFRECSIEMIPEERRKRINLS-RNSKYYMKKLL 353 (366)
Q Consensus 320 klGF~~~g~~~lp~~~~~~y~~~-r~s~vl~k~L~ 353 (366)
|+||+..+...+|..++..|+.+ +++++|+|+|.
T Consensus 421 k~GF~~~~~~~~p~~~~~~y~~~~r~~~v~~k~L~ 455 (456)
T 3d2m_A 421 ERGFQTASEDELPETRRKDYRSNGRNSHILVRRLH 455 (456)
T ss_dssp TTTCEEECGGGSCHHHHHHHHHHCCCCEEEEEECC
T ss_pred HCCCEEeCcccCCHHHHhhcccccCCeEEEEEEcC
Confidence 99999999999999999999999 99999999985
|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* | Back alignment and structure |
|---|
| >3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* | Back alignment and structure |
|---|
| >2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 | Back alignment and structure |
|---|
| >2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 | Back alignment and structure |
|---|
| >2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 | Back alignment and structure |
|---|
| >3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A* | Back alignment and structure |
|---|
| >3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* | Back alignment and structure |
|---|
| >1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A* | Back alignment and structure |
|---|
| >2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A* | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803} | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A* | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >4axs_A Carbamate kinase; oxidoreductase; 2.50A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A* | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} SCOP: c.73.1.0 PDB: 3ek5_A | Back alignment and structure |
|---|
| >2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A* | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* | Back alignment and structure |
|---|
| >3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 | Back alignment and structure |
|---|
| >3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* | Back alignment and structure |
|---|
| >3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A | Back alignment and structure |
|---|
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* | Back alignment and structure |
|---|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4 | Back alignment and structure |
|---|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 366 | ||||
| d1qsra_ | 162 | d.108.1.1 (A:) Catalytic domain of GCN5 histone ac | 8e-12 | |
| d2bufa1 | 300 | c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Ps | 1e-11 | |
| d2bufa1 | 300 | c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Ps | 2e-06 | |
| d2gana1 | 182 | d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P | 1e-11 | |
| d1i12a_ | 157 | d.108.1.1 (A:) Glucosamine-phosphate N-acetyltrans | 3e-11 | |
| d1ygha_ | 164 | d.108.1.1 (A:) Catalytic domain of GCN5 histone ac | 6e-11 | |
| d2btya1 | 282 | c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Th | 6e-11 | |
| d2btya1 | 282 | c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Th | 2e-07 | |
| d1n71a_ | 180 | d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera | 7e-11 | |
| d2ap9a1 | 291 | c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {My | 7e-11 | |
| d1r57a_ | 102 | d.108.1.1 (A:) Hypothetical protein SA2309 {Staphy | 8e-11 | |
| d1yx0a1 | 151 | d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bac | 5e-10 | |
| d1z4ra1 | 162 | d.108.1.1 (A:497-658) Catalytic domain of GCN5 his | 9e-10 | |
| d2hv2a2 | 285 | d.108.1.10 (A:2-286) Hypothetical protein EF1021 { | 2e-09 | |
| d1gs5a_ | 258 | c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escheri | 9e-09 | |
| d1sqha_ | 297 | d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr | 2e-08 | |
| d1y9ka1 | 152 | d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillu | 2e-08 | |
| d2i00a2 | 291 | d.108.1.10 (A:10-300) Putative acetyltransferase E | 3e-08 | |
| d1y9wa1 | 140 | d.108.1.1 (A:1-140) Probable acetyltransferase BC2 | 4e-08 | |
| d1vkca_ | 149 | d.108.1.1 (A:) Putative acetyltransferase PF0028 { | 8e-08 | |
| d2aj6a1 | 118 | d.108.1.1 (A:1-118) Hypothetical protein MW0638 {S | 1e-07 | |
| d1m4ia_ | 181 | d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransfera | 2e-07 | |
| d2fiaa1 | 157 | d.108.1.1 (A:1-157) Probable acetyltransferase EF1 | 3e-07 | |
| d2i6ca1 | 160 | d.108.1.1 (A:1001-1160) Putative acetyltransferase | 4e-07 | |
| d1z4ea1 | 150 | d.108.1.1 (A:4-153) Transcriptional regulator BH19 | 4e-07 | |
| d2g3aa1 | 137 | d.108.1.1 (A:1-137) Probable acetyltransferase Atu | 1e-06 | |
| d1u6ma_ | 189 | d.108.1.1 (A:) Putative acetyltransferase EF0945 { | 3e-05 | |
| d1p0ha_ | 308 | d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter | 4e-05 | |
| d1ghea_ | 170 | d.108.1.1 (A:) Tabtoxin resistance protein {Pseudo | 7e-05 | |
| d1tiqa_ | 173 | d.108.1.1 (A:) Protease synthase and sporulation n | 1e-04 | |
| d1b7ba_ | 307 | c.73.1.1 (A:) Carbamate kinase {Enterococcus faeci | 1e-04 | |
| d1cjwa_ | 166 | d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep | 1e-04 | |
| d1ufha_ | 155 | d.108.1.1 (A:) Putative acetyltransferase YycN {Ba | 3e-04 | |
| d1s3za_ | 147 | d.108.1.1 (A:) Aminoglycoside N-acetyltransferase | 3e-04 |
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Catalytic domain of GCN5 histone acetyltransferase species: Tetrahymena thermophila [TaxId: 5911]
Score = 60.9 bits (147), Expect = 8e-12
Identities = 19/111 (17%), Positives = 44/111 (39%), Gaps = 2/111 (1%)
Query: 246 SFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLD 305
S +++ + ++I + ++ EVA + V+ + +G G +L++ + ++
Sbjct: 48 SMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIE 107
Query: 306 MLFLLTTRTA-DWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPD 355
L A +FK +GF + M E+ + I + P
Sbjct: 108 YLLTYADNFAIGYFKKQGFTK-EHRMPQEKWKGYIKDYDGGTLMECYIHPY 157
|
| >d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Length = 300 | Back information, alignment and structure |
|---|
| >d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Length = 300 | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182 | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 157 | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
| >d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Length = 282 | Back information, alignment and structure |
|---|
| >d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Length = 282 | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180 | Back information, alignment and structure |
|---|
| >d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 291 | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Length = 102 | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Length = 151 | Back information, alignment and structure |
|---|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Length = 285 | Back information, alignment and structure |
|---|
| >d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Length = 258 | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297 | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Length = 152 | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Length = 291 | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Length = 140 | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149 | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Length = 118 | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Length = 157 | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Length = 160 | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Length = 150 | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Length = 137 | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Length = 189 | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308 | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Length = 170 | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Length = 173 | Back information, alignment and structure |
|---|
| >d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Length = 307 | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Length = 166 | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Length = 155 | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Length = 147 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 366 | |||
| d2bufa1 | 300 | N-acetyl-l-glutamate kinase {Pseudomonas aeruginos | 99.94 | |
| d2btya1 | 282 | N-acetyl-l-glutamate kinase {Thermotoga maritima [ | 99.92 | |
| d2ap9a1 | 291 | N-acetyl-l-glutamate kinase {Mycobacterium tubercu | 99.9 | |
| d1b7ba_ | 307 | Carbamate kinase {Enterococcus faecium [TaxId: 135 | 99.8 | |
| d1e19a_ | 313 | Carbamate kinase {Archaeon Pyrococcus furiosus [Ta | 99.78 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 99.77 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 99.74 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 99.74 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 99.74 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 99.73 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 99.73 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 99.73 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 99.73 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.72 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 99.71 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 99.71 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 99.71 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 99.7 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 99.7 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 99.69 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 99.68 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 99.68 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 99.67 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 99.66 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 99.66 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 99.65 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 99.65 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 99.64 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 99.63 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 99.62 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 99.62 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 99.61 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 99.61 | |
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.61 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 99.6 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 99.59 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 99.59 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 99.59 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 99.59 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 99.58 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 99.57 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 99.56 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 99.55 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 99.53 | |
| d1gs5a_ | 258 | N-acetyl-l-glutamate kinase {Escherichia coli [Tax | 99.53 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 99.51 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 99.5 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 99.46 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 99.41 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 99.4 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 99.38 | |
| d2akoa1 | 250 | Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1 | 99.38 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 99.36 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 99.36 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 99.35 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 99.35 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 99.34 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 99.31 | |
| d2brxa1 | 225 | Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: | 99.3 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 99.26 | |
| d2fsra1 | 164 | Probable acetyltranferase Atu2435 {Agrobacterium t | 99.21 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 99.18 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 99.18 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 99.12 | |
| d2ij9a1 | 219 | Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax | 99.06 | |
| d2a1fa1 | 236 | Uridylate kinase PyrH {Haemophilus influenzae [Tax | 98.83 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 98.62 | |
| d1ybda1 | 236 | Uridylate kinase PyrH {Neisseria meningitidis [Tax | 98.45 | |
| d1ro5a_ | 197 | Autoinducer synthesis protein LasI {Pseudomonas ae | 98.34 | |
| d1z9da1 | 238 | Uridylate kinase PyrH {Streptococcus pyogenes [Tax | 97.97 | |
| d1xmta_ | 95 | Hypothetical protein AT1g77540 {Thale cress (Arabi | 97.69 | |
| d1kzfa_ | 210 | Acyl-homoserinelactone synthase EsaI {Pantoea stew | 97.63 | |
| d1ylea1 | 338 | Arginine N-succinyltransferase, alpha chain, AstA | 97.63 | |
| d2hmfa1 | 302 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 97.57 | |
| d2cdqa1 | 304 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 97.35 | |
| d1lrza3 | 182 | Methicillin resistance protein FemA {Staphylococcu | 96.78 | |
| d2j0wa1 | 292 | Aspartokinase {Escherichia coli [TaxId: 562]} | 95.84 | |
| d1boba_ | 315 | Histone acetyltransferase HAT1 {Baker's yeast (Sac | 95.47 | |
| d1ne9a2 | 171 | Peptidyltransferase FemX {Weissella viridescens [T | 94.97 | |
| d2d4pa1 | 130 | Hypothetical protein TTHA1254 {Thermus thermophilu | 94.8 | |
| d2giva1 | 271 | Probable histone acetyltransferase MYST1 {Human (H | 93.93 | |
| d2ozua1 | 270 | Histone acetyltransferase MYST3 {Human (Homo sapie | 92.7 | |
| d1fy7a_ | 273 | Histone acetyltransferase ESA1 {Baker's yeast (Sac | 92.44 | |
| d1iica2 | 237 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 92.05 | |
| d1iica1 | 185 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 91.97 | |
| d1iyka1 | 165 | N-myristoyl transferase, NMT {Yeast (Candida albic | 91.57 | |
| d1iyka2 | 227 | N-myristoyl transferase, NMT {Yeast (Candida albic | 91.37 | |
| d1rxta1 | 141 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 90.13 | |
| d1ne9a1 | 164 | Peptidyltransferase FemX {Weissella viridescens [T | 83.51 |
| >d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Carbamate kinase-like superfamily: Carbamate kinase-like family: N-acetyl-l-glutamate kinase domain: N-acetyl-l-glutamate kinase species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.94 E-value=4.2e-27 Score=221.90 Aligned_cols=130 Identities=28% Similarity=0.484 Sum_probs=120.0
Q ss_pred CcccccCCceEEEcCcccCCCCCeeecCHHHHHHHHHHHcCCCEEEEEecCccc-ccCCcccccCCHHHHHHHHHHhhhh
Q 017745 1 MRERLDGGCLVILSNLGYSSSGEVLNCNTYEVATACALAIEADKLICIIDGPIL-DESGHLIRFLTLQEADSLIRQRVKQ 79 (366)
Q Consensus 1 i~~ll~~g~ipvi~~~g~~~~g~~~nin~D~~A~~~A~al~a~kLi~ltd~~~~-~~~~~~i~~l~~~~~~~l~~~~~~~ 79 (366)
|+.+|++|+|||++|+|++++|+++|+|+|++|+++|.+|+|||||||||++++ +.+++++++++..+++++++++.
T Consensus 169 i~~ll~~g~Ipvis~~~~~~~G~~~nin~D~~Aa~lA~~L~AdkLI~Ltdv~Gv~~~~g~~~~~l~~~~~~~li~~~~-- 246 (300)
T d2bufa1 169 LNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGT-- 246 (300)
T ss_dssp HHHHHHTTCEEEEEEEEECTTSCEEECCHHHHHHHHHHHHTCSEEEEEESSSCCBCTTSCBCCEECHHHHHHHHHTTC--
T ss_pred HHHHhcCCCeEEecccccCcccchhcccHHHHHHHHHHHcCCCeEEEEcCCCccccCCCcchhhccHHHHHHHHHcCC--
Confidence 357899999999999999999999999999999999999999999999999955 78899999999999999987654
Q ss_pred hHHHHhHHhhhhccccccccCCCCCCccccCCCCCccchhhhhhccCCCccCCCCCCcccccccccccchhhhhccccHH
Q 017745 80 SEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLS 159 (366)
Q Consensus 80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 159 (366)
+ ++ | |.+
T Consensus 247 ------------------i---------------------------------~g-G---------------------M~~ 253 (300)
T d2bufa1 247 ------------------I---------------------------------YG-G---------------------MLP 253 (300)
T ss_dssp ------------------S---------------------------------CT-T---------------------HHH
T ss_pred ------------------c---------------------------------Cc-h---------------------HHH
Confidence 0 22 3 999
Q ss_pred HHHHHHHHHHcCCceEEeeccccCcchhhhhhhcCCCccccccCcc
Q 017745 160 ELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLY 205 (366)
Q Consensus 160 ~l~~A~~al~~Gv~rv~iv~g~~~~~ll~elfs~~g~gTmi~~d~~ 205 (366)
||++|..||..||+||||++++.+++++.|+|+++|.||+|+++.|
T Consensus 254 Kl~aa~~a~~~Gv~rv~Ii~g~~~~~ll~eLft~~g~GT~I~~~~~ 299 (300)
T d2bufa1 254 KIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISNRKR 299 (300)
T ss_dssp HHHHHHHHHHTTCSEEEEEETTSTTHHHHHHSSTTCCSEEEECCCC
T ss_pred HHHHHHHHHHcCCCEEEEecCCCCCHHHHHHcCCCCceeEEecCCC
Confidence 9999999999999999999999999999999999999999998865
|
| >d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} | Back information, alignment and structure |
|---|
| >d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hmfa1 c.73.1.3 (A:2-303) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} | Back information, alignment and structure |
|---|
| >d2d4pa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ne9a1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} | Back information, alignment and structure |
|---|