Citrus Sinensis ID: 017773

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MSNFHDHQQPQAETTNERARCEWDFNLRTTVSSSSSPNAAVSDSIGVIEFDPSDSVFATGGIARKIRIYNIKSVLVDHPVVAVVDHSKVCDYYICTPAKLSSLKWKPGTSGRVLGSGDYDGVVMEYDLEKKVPIFERDEHGGRRVWSVDYSKGDPVLGASGSDDGTMQMWDPRCDGGKCVSTVQPSASRSAVCCVEFHPFGSSLVAAGCADKKAYAYDVRKMVDPVLVFDGHRKTVTYIRFLDVDTLVTAGTDGCLKLWNVNDSRVIRTYKGHVNNRNFVGLSVWRHGGLLGCGSETNQVFVYDVRWGEPVWVHDFEPVTAAGSERGFVSSVCWRRVGEDECTLVAGGSDGLLHVFVGKKKPLSAQ
ccccccccccEEEEcccccEEEEEcccccEEEEcccccccccccEEEEEEcccccEEEEECccccEEEEEcccccccccEEEECccccCEEEEEEccccEEEEEEcccccccEEEEEcccccEEEEEccccCEEEEEccccccEEEEEEEcccccEEEEEEcccccEEEEccccccccEEEEEccccccccEEEEEEcccccEEEEEEEccccEEEEEcccccccEEccccccccEEEEEEccccEEEEECccccEEEEEcccccEEEEEccccccEEEEEEEEcccccEEEEccccccEEEEEcccccEEEEECcccccccccccccEEEEEEEECcccccEEEEEcccccEEEEEcccccECcc
*SNFHDHQQPQAETTNERARCEWDFNLRTTVSSSSSPNAAVSDSIGVIEFDPSDSVFATGGIARKIRIYNIKSVLVDHPVVAVVDHSKVCDYYICTPAKLSSLKWKPGTSGRVLGSGDYDGVVMEYDLEKKVPIFERDEHGGRRVWSVDYSKGDPVLGASGSDDGTMQMWDPRCDGGKCVSTVQPSASRSAVCCVEFHPFGSSLVAAGCADKKAYAYDVRKMVDPVLVFDGHRKTVTYIRFLDVDTLVTAGTDGCLKLWNVNDSRVIRTYKGHVNNRNFVGLSVWRHGGLLGCGSETNQVFVYDVRWGEPVWVHDFEPVTAAGSERGFVSSVCWRRVGEDECTLVAGGSDGLLHVFVG*KKP****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNFHDHQQPQAETTNERARCEWDFNLRTTVSSSSSPNAAVSDSIGVIEFDPSDSVFATGGIARKIRIYNIKSVLVDHPVVAVVDHSKVCDYYICTPAKLSSLKWKPGTSGRVLGSGDYDGVVMEYDLEKKVPIFERDEHGGRRVWSVDYSKGDPVLGASGSDDGTMQMWDPRCDGGKCVSTVQPSASRSAVCCVEFHPFGSSLVAAGCADKKAYAYDVRKMVDPVLVFDGHRKTVTYIRFLDVDTLVTAGTDGCLKLWNVNDSRVIRTYKGHVNNRNFVGLSVWRHGGLLGCGSETNQVFVYDVRWGEPVWVHDFEPVTAAGSERGFVSSVCWRRVGEDECTLVAGGSDGLLHVFVGKKKPLSAQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat-containing protein RUP2 Functions in association with RUP1 as repressor of UV-B-induced photomorphogenesis mediated by UVR8 and HY5. Play a crucial negative feedback regulatory role downstream of UVR8-COP1 to inhibit UVR8 function, balance UV-B-specific responses and ensure normal plant growth. Is involved in the regulation of photoperiodic flowering and vegetative development. May act as negative regulator of photoperiodic flowering by suppressing flowering through the action of CONSTANS (CO) and FLOWERING LOCUS T (FT).probableQ9FFA7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AOW, chain A
Confidence level:very confident
Coverage over the Query: 39-360
View the alignment between query and template
View the model in PyMOL
Template: 3MKQ, chain A
Confidence level:very confident
Coverage over the Query: 11-82,93-360
View the alignment between query and template
View the model in PyMOL